Recombinant Human NKG2-D type II integral membrane protein(KLRK1),partial (Active)

In Stock
Code CSB-MP012474HU1
Size US$278
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml. Biological Activity Assay
  • Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay. Biological Activity Assay
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

The human NKG2-D type II integral membrane protein or KLRK1 is a costimulatory receptor expressed in Natural Killers and CD8+ T-cells. KLRK1 participates in the immunosurveillance of tumor and virus-infected cells and mediates the activation of T-cell receptors in CD8+ cells, causing the amplification of the T-cell-mediated adaptative immune response. This target protein KLRK1 also modulates natural immunity by activating the NK cell cytotoxic activity. It’s activated by the interaction of stress-induced ligands presented on the surface by the MHC class I binding proteins. This recombinant product is the 78-216aa region of the KLRK1 protein, which is expressed in mammalian cells and fused on the C-terminus with an Fc tag. It has a final molecular weight of 43.6 kDa. This product has a purity higher than 93%, as measure by SDS-PAGE. The affinity constant of this protein against ULBP1 was 2.27 nM as detected by LSPR, and the EC50 was 222.4-276.0 ng/ml, as determined by ELISA binding assay. The protein can be used in immunity modulation and immunosuppression studies on cancer and viral diseases. The final product has low levels of endotoxin, with less than 1.0 EU/µg as determined by the LAL method.

Purity Greater than 93% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity ①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.②Human KLRK1 protein Fc tag (CSB-MP012474HU1) captured on COOH chip can bind Human ULBP1 protein Fc/myc tag (CSB-MP887177HU) with an affinity constant of 2.27 nM as detected by LSPR Assay.
Target Names KLRK1
Uniprot No. P26718
Research Area Cancer
Alternative Names CD314; CD314 antigen ; D12S2489E; Killer cell lectin like receptor subfamily K member 1; Killer cell lectin-like receptor subfamily K member 1; KLR; KLRC4 KLRK1 readthrough; KLRK1; NK cell receptor D; NK lectin-like receptor; NKG2 D activating NK receptor; NKG2 D type II integral membrane protein; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; Nkg2d; NKG2D_HUMAN; NKLLR; NKR P2; Nkrp2
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 78-216aa
Target Protein Sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
Mol. Weight 43.6 kDa
Protein Length Partial
Tag Info C-terminal hFc-tagged
Form Liquid or Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.
Subcellular Location Cell membrane, Single-pass type II membrane protein
Tissue Specificity Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).
Database Links

HGNC: 18788

OMIM: 611817

KEGG: hsa:100528032

STRING: 9606.ENSP00000240618

UniGene: Hs.387787

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1