Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial (Active)

In Stock
Code CSB-BP737873HU
Abbreviation Recombinant Human NCR3LG1 protein, partial (Active)
MSDS
Size $400
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human NCR3LG1 at 2 μg/mL can bind Anti-NCR3LG1 recombinant antibody(CSB-RA737873MA1HU). The EC50 is 10.90-12.22 ng/mL.
Target Names
Uniprot No.
Alternative Names
Natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6 (B7-H6); NCR3LG1; B7H6
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
25-262aa
Target Protein Sequence
DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
Mol. Weight
28.1 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Triggers NCR3-dependent natural killer cell activation.
Gene References into Functions
  1. B7-H6 was expressed in gliomas and correlated with glioma progression. Knockdown of B7-H6 inhibited glioma cell proliferation, colony formation, migration, and invasion via upregulation of E-cadherin and Bax, and downregulation of vimentin, N-cadherin, MMP-2, MMP-9 and survivin. PMID: 29679856
  2. these studies find that soluble B7H6 is constitutively expressed during pregnancy PMID: 29055565
  3. Data suggest that B7-H6 play an important role in the regulation of the biological behavior of glioma cells. PMID: 28415577
  4. Data indicate a sequence of events driven by tumour-derived prostaglandin D2 (PGD2) associated with engagement of the natural cytotoxicity triggering receptor 3 (NKp30)-B7H6 antigen (B7H6) pathway leading to significant group 2 innate lymphoid cells (ILC2s) activation and expansion. PMID: 28928446
  5. B7H6-derived peptides trigger TNF-alpha-dependent immunostimulatory activity of lymphocytic NK92-MI cells. PMID: 27216712
  6. Study confirms that B7-H6 is widely expressed in B-cell lymphomas and demonstrates its important role in the pathogenesis and chemosensitivity of lymphoma. PMID: 26891663
  7. our present data revealed that higher B7-H6 expression in ovarian cancer tissues was positively correlated with tumor metastasis and cancer progression PMID: 26464699
  8. NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases. PMID: 26582946
  9. study not only reveals the possibility that tumor therapeutics work as stress inducers to enhance tumor sensitivity to NK cell cytolysis but also suggests that B7-H6 could be a potential target for tumor therapy in the future PMID: 26472927
  10. Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure PMID: 26241657
  11. the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patients PMID: 25877893
  12. Study suggests that B7-H6 has a limited value as a prognostic marker in non-small cell lung cancer patients. PMID: 25400778
  13. this study identified ectodomain shedding of B7-H6 by the metalloproteases "a disintegrin and metalloproteases" (ADAM)-10 and ADAM-17 from the cell surface of tumor cells as a crucial mechanism of expression regulation of B7-H6. PMID: 24780758
  14. B7-H6-positive carcinomas were significantly associated with a higher differentiation. PMID: 24242703
  15. Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction. PMID: 25001651
  16. Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6. PMID: 24275655
  17. These findings reveal that B7-H6 is not only implicated in tumor immunosurveillance but also participates in the inflammatory response in infectious conditions. PMID: 23687088
  18. B7-H6:7D8 represents the first Ab-based molecule stimulating NKp30-mediated NK cell cytotoxicity for therapeutic purposes PMID: 23066150
  19. The NKp30-B7-H6 structure revealed that this NK cell activating complex is distinct from the CTLA4-B7 and PD-1-PD-L T cell inhibitory complexes in both overall organization and detailed atomic interactions that mediate binding and specificity. PMID: 21422170
  20. DKFZp686O24166 was designated the gene B7-H6; identification as a tumor cell surface molecule that binds NKp30, a receptor which triggers antitumor NK cell cytotoxicity and cytokine secretion PMID: 19528259

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Not detected in any normal tissue tested. Expressed at the surface of several tumor cell lines including T and B-lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells (at protein level).
Database Links

HGNC: 42400

OMIM: 613714

KEGG: hsa:374383

STRING: 9606.ENSP00000341637

UniGene: Hs.146274

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*