Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is less than 3 ng/mL.
Research Area
Neuroscience
Alternative Names
Acetylcholine receptor-inducing activity; Acetylcholine receptor-inducing activity, chick, homolog of; ARIA; Breast cancer cell differentiation factor p45; GGF; GGF2; glial growth factor 2; Glial growth factor; Heregulin; heregulin, alpha (45kD, ERBB2 p185-activator); heregulin, alpha; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; Neu differentiation factor; Neuregulin-1; nrg1; NRG1-IT2; NRG1_HUMAN; Pro-NRG1; Sensory and motor neuron-derived factor; SMDF
Species
Homo sapiens (Human)
Expression Region
177-241aa
Complete Sequence
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Protein Length
Partial of Isoform 6
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human NRG1 is a partial protein representing the 177-241aa expression region of isoform 6 of Pro-neuregulin-1, a critical protein in neuroscience research. Produced in E. coli, this tag-free protein showcases a purity greater than 95%, as verified by SDS-PAGE. The endotoxin level is less than 1.0 EU/µg, as determined by the LAL method. NRG1's bioactivity is demonstrated through an ED50 of less than 3 ng/mL, as established in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The recombinant protein is provided in a lyophilized powder format, allowing for easy storage and use in various research applications.