Recombinant Human Tumor necrosis factor ligand superfamily member 18 (TNFSF18), partial (Active)

In Stock
Code CSB-MP891791HU
Abbreviation Recombinant Human TNFSF18 protein, partial (Active)
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml. Biological Activity Assay
  • Activity
    Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.
Target Names
Uniprot No.
Alternative Names
(AITRL)(hGITRL)(AITRL)(GITRL)(TL6)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
72-199aa
Target Protein Sequence
QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Mol. Weight
42.8
Protein Length
Partial
Tag Info
N-terminal hFc-Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

TNFSF18 (GITRL) plays a critical role in T-cell costimulation and regulatory T-cell homeostasis, making it a key target for immuno-oncology and autoimmunity research. This recombinant human TNFSF18 (aa 72–199), bearing an N-terminal hFc-Flag tag and expressed in mammalian cells, demonstrates robust receptor engagement with an EC50 of 2.565–2.940 ng/ml against immobilized TNFRSF18 in functional ELISA, and a KD of 38.5 nM by LSPR, confirming signaling-competent conformation suitable for NF-κB pathway activation studies and T-cell costimulation assays. The sub-nanogram EC50 supports use as a coating antigen or positive control in antibody development campaigns, while endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in sensitive primary T-cell proliferation and activation experiments. Purity exceeding 90% by SDS-PAGE, combined with this stringent endotoxin profile, satisfies the quality criteria typical for cell-based functional assays and in vivo tumor biology models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T-cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Triggers increased phosphorylation of STAT1 and up-regulates expression of VCAM1 and ICAM1. Promotes leukocyte adhesion to endothelial cells. Regulates migration of monocytes from the splenic reservoir to sites of inflammation.
Gene References into Functions
  1. GITRL levels are significantly elevated in rheumatoid arthritis serum and synovial fluid and are positively correlated with autoantibody production in rheumatoid arthritis, suggesting a role of GITRL in the development of rheumatoid arthritis. PMID: 27098050
  2. GITRL modulates the activities of p38 MAPK and STAT3 to promote Th17 cell differentiation in autoimmune arthritis. PMID: 26657118
  3. An increase in GITRL may impair the balance of Th17/Treg, and contribute to the pathopoiesis of Hashimoto's thyroiditis. PMID: 25429429
  4. Serum GITRL levels were higher in SLE patients. PMID: 23251213
  5. Glucocorticoid-induced TNF-related ligand (GITRL) confers pseudoexpression to tumor cells by platelets, which results in GITRL expression by megakaryocytes and their platelet progeny. PMID: 22649191
  6. observation suggests a link between cytokine-regulated keratinocyte GITRL expression and its role in inflammatory responses in AD PMID: 22417213
  7. GITRL upregulation induced by IFN-beta on dendritic cells downregulates CTLA-4 on regulatory T (Treg) cells, facilitating proliferation of anergic Treg cells in multiple sclerosis treatment of multiple sclerosis patients. PMID: 22112394
  8. GITRL expression on Kupffer cells may mediate acute rejection in liver transplantation PMID: 21693309
  9. The incorporation of an isoleucine zipper motif could markedly improve the costimulation of hsGITRL. PMID: 20228835
  10. Upregulation by proinflammatory cytokines suggests GITRL may play important role in ocular immunity. High level of constitutive GITRL expression on photoreceptor inner segments suggests photoreceptors participate in regulation of ocular inflammation. PMID: 15326137
  11. Regulates ossteoclasst genersation and substantiate the major role played by the endothelium in bone physiology. PMID: 16179414
  12. Using a GITRL-transfected cell line, we demonstrate that GITRL promotes NK cell cytotoxicity and IFN-gamma production. PMID: 16397134
  13. GITRL could be a potential candidate for regulation of the ocular immune privilege and the balance between immune privilege and inflammation PMID: 16874737
  14. Constitutive expression of GITRL by tumor cells diminishes natural killer cell antitumor immunity. PMID: 17360848
  15. although huGITRL is not capable of alleviating Treg suppression of responder T cells, huGITRL overexpression on monocyte-derived DC enhances their capacity to induce antigen-specific T cell responses PMID: 17449724
  16. These observations raise the possibility that the GITRL-mediated inflammatory activation of macrophages is involved in the pathogenesis of inflammatory diseases. PMID: 17602748
  17. Levels of AITRL were significantly increased in serum of breast cancer patients PMID: 17914571
  18. hGITRL ectodomain displays considerable self-association/dissociation in solution with a dynamic equilibrium between trimeric and monomeric forms over the range of protein concentrations studied. PMID: 18040044
  19. identify multiple oligomeric species of hGITRL that possess distinct kinetics of ERK activation. PMID: 18378892
  20. The strong correlation of tumor incidence and elevated soluble GITRL levels indicates that soluble GITRL is released from cancers in vivo, leading to impaired NK cell immunosurveillance of tumors PMID: 18689545

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.
Database Links

HGNC: 11932

OMIM: 603898

KEGG: hsa:8995

STRING: 9606.ENSP00000385470

UniGene: Hs.248197

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*