Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized TNFRSF18 at 2 μg/ml can bind TNFSF18 (CSB-MP891791HU), the EC50 is 2.565 to 2.940 ng/ml.②Human TNFRSF18 protein hFc tag (CSB-MP896537HU) captured on COOH chip can bind Human TNFSF18 protein hFc and Flag tag (CSB-MP891791HU) with an affinity constant of 38.5 nM as detected by LSPR Assay.
Alternative Names
(AITRL)(hGITRL)(AITRL)(GITRL)(TL6)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
72-199aa
Target Protein Sequence
QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Tag Info
N-terminal hFc-Flag-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The DNA fragment encoding the human TNFSF18 (Gln72-Ser199) was expressed with a C-terminal hFc-Flag-tag in the mammalian cells. The expressed protein is the recombinant human TNFSF18 protein with low endotoxin (< 1.0 EU/µg protein, LAL method) and high purity (> 90%, SDS-PAGE). This TNFSF18 protein displayed a molecular weight of approximately 45 kDa on the gel due to glycosylation. It is biologically active. In the functional ELISA, TNFRSF18 can bind to TNFSF18, with the EC50 is 2.565 to 2.940 ng/ml. In the LSPR assay, the human TNFRSF18 protein can bind to this TNFSF18 protein, with an affinity constant of 38.5 nM. This recombinant TNFSF18 protein is in stock now.
TNFSF18, also called GITRL, is expressed in APCs and functions as a costimulatory molecule in the immune system. TNFSF18 engagement with its cognate receptor TNFRSF18 promotes proliferation and cytokine production of both CD4+ Teff and Treg cells, as well as drives the antitumor activity of CD8+ T cells. Besides, TNFRSF18/TNFSF18 signaling is implicated in the pathogenesis of inflammation, autoimmune diseases, and tumor.
