Purity

≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 4.299-5.373 ng/mL.

Target Names

CD276

Uniprot No.

A0A7N9CYV2

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

29-465aa

Target Protein Sequence

LEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFLDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPE

Mol. Weight

48.4 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD276 (B7-H3) functions as an immune checkpoint molecule with context-dependent co-stimulatory and co-inhibitory roles, making it a target of interest in cancer immunotherapy and transplantation research. This cynomolgus macaque ortholog, spanning residues 29–465 of the extracellular domain and expressed in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantifiable binding to an anti-CD276 recombinant antibody with an EC50 of 4.299–5.373 ng/mL in functional ELISA, confirming conformational integrity suitable for therapeutic antibody epitope mapping, blocking antibody screening, and competitive inhibition assays. The low endotoxin level (less than 1.0 EU/μg) combined with greater than 95% purity supports use in surface plasmon resonance and biolayer interferometry experiments for affinity characterization of candidate biologics targeting the CD276 pathway. This protein provides a suitable basis for drug discovery workflows focused on immune checkpoint modulation in preclinical primate models.

Code	CSB-MP5140MOV
Abbreviation	Recombinant Cynomolgus monkey CD276 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$116
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD276 at 2 μg/ml can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC₅₀ is 4.299-5.373 ng/mL. Biological Activity Assay The purity of CD276 was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis CD276 molecule(CD276),partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage