Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)

In Stock
Code CSB-MP011050MOW
Abbreviation Recombinant Rhesus macaque IFNG protein (Active)
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/ml can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 35.23-38.98 ng/mL. Biological Activity Assay
  • Activity
    Measured by its ability to inhibit proliferation of HT-29 cells.The ED50 for this effect is 0.1870-0.4067 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Macaca mulatta IFNG at 2 μg/mL can bind anti-IFNG recombinant antibody (CSB-RA011050MA1HU).The EC50 is 35.23-38.98 ng/mL.
②Measured by its ability to inhibit proliferation of HT-29 cells.The ED50 for this effect is 0.1870-0.4067 ng/mL.
Target Names
Uniprot No.
Alternative Names
Interferon gamma; IFN-gamma; IFNG
Species
Macaca mulatta (Rhesus macaque)
Source
Mammalian cell
Expression Region
24-165aa
Target Protein Sequence
QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Mol. Weight
18.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Interferon gamma orchestrates macrophage activation, MHC class II upregulation, and antiviral defense, making it a central node in primate immune response studies. This recombinant rhesus macaque IFNG, spanning the complete mature protein sequence (aa 24–165), demonstrates quantifiable binding activity with an EC50 of 35.23–38.98 ng/mL in a functional ELISA against a recombinant anti-IFNG antibody, providing a validated basis for antibody development workflows including epitope mapping, ELISA standardization, and immunogen characterization. The endotoxin level below 1.0 EU/μg meets the contamination thresholds commonly required for cell-based assays where LPS artifacts would confound readouts of JAK-STAT signaling, macrophage polarization, or T-cell activation. Purity exceeding 95% by SDS-PAGE, combined with the mammalian expression platform, supports use in primary PBMC stimulation experiments, cytokine detection assay calibration, and non-human primate infection models where native glycosylation and folding are critical for receptor engagement.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type II interferon produced by immune cells such as T-cells and NK cells that plays crucial roles in antimicrobial, antiviral, and antitumor responses by activating effector immune cells and enhancing antigen presentation. Primarily signals through the JAK-STAT pathway after interaction with its receptor IFNGR1 to affect gene regulation. Upon IFNG binding, IFNGR1 intracellular domain opens out to allow association of downstream signaling components JAK2, JAK1 and STAT1, leading to STAT1 activation, nuclear translocation and transcription of IFNG-regulated genes. Many of the induced genes are transcription factors such as IRF1 that are able to further drive regulation of a next wave of transcription. Plays a role in class I antigen presentation pathway by inducing a replacement of catalytic proteasome subunits with immunoproteasome subunits. In turn, increases the quantity, quality, and repertoire of peptides for class I MHC loading. Increases the efficiency of peptide generation also by inducing the expression of activator PA28 that associates with the proteasome and alters its proteolytic cleavage preference. Up-regulates as well MHC II complexes on the cell surface by promoting expression of several key molecules such as cathepsins B/CTSB, H/CTSH, and L/CTSL. Participates in the regulation of hematopoietic stem cells during development and under homeostatic conditions by affecting their development, quiescence, and differentiation.
Gene References into Functions
  1. IFNgamma expression in colonic epithelial cells was regulated by TGFB1. PMID: 25769244
  2. Higher KIR2DL4 copy numbers is associated with an increased IFN-gamma production in NK cell subsets in SIV-infected Mamu-A*01-negative rhesus macaques. PMID: 23449795
  3. Data show that viral set-point in simian immunodeficiency virus diseasewas is associated with expression of interferon gamma -stimulated genes. PMID: 17719201
  4. Low Sociable animals showed alterations in lymph node expression of the immunoregulatory cytokine interferon-gamma. PMID: 18068331
Subcellular Location
Secreted.
Protein Families
Type II (or gamma) interferon family
Tissue Specificity
Released primarily from activated T lymphocytes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*