Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse ACVR2A at 2 μg/mL can bind Anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU). The EC50 is 1.562-1.966 ng/mL.

Target Names

ACVR2A

Uniprot No.

P27038

Alternative Names

Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA); Acvr2a; Acvr2

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

20-135aa

Target Protein Sequence

AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Mol. Weight

14.8 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Activin receptor type-2A mediates signaling by activin and related TGF-β superfamily ligands, making it a critical node in pathways governing muscle homeostasis, metabolism, and immune regulation. This recombinant fragment spanning residues 20–135 captures the extracellular ligand-binding domain and demonstrates quantifiable antibody-binding activity with an EC50 of 1.562–1.966 ng/mL in functional ELISA, providing a validated reagent for competitive inhibition assays, blocking antibody screening, and therapeutic antibody epitope mapping. Mammalian expression ensures native glycosylation and disulfide bond formation, which are essential for preserving the conformational epitopes required in surface plasmon resonance, biolayer interferometry, and other affinity characterization platforms. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for ligand-binding studies and drug discovery campaigns targeting the activin–myostatin axis.

Target Background

Function

On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.

Gene References into Functions

Activation of ActRIIA signaling during early chronic kidney disease contributes to the CKD-MBD components of osteodystrophy and cardiovascular disease and to renal fibrosis. PMID: 28843411
blocking activin/ACVR2A impaired the potency of hepatic stellate cells to produce collagens in response to IL17s. PMID: 29620144
Anti-ActRII blockade is an effective intervention against cancer cachexia providing benefit even in the presence of anti-cancer therapies. PMID: 27462398
Data, including data from studies using transgenic mice, suggest that osteoblasts deficient in Acvr2A exhibit un-characteristic features; osteoclasts deficient in Acvr2A or Acvr2B or both appear normal. Acvr2A-deficient mice exhibit significantly increased femoral trabecular bone volume at 6 weeks of age; Acvr2B-deficient mice exhibit no significant change in any bone parameter. PMID: 28659341
miR-125b regulated the activin/Smad2 signaling in neonatal mouse ovary by directly targeting the 3'-untranslated region of activin receptor type 2a PMID: 26962113
Our study shows that a miR-590/Acvr2a/Rad51b signaling axis ensures the stabilization of mESCs by balancing DNA damage repair and rapid proliferation during self-renewal. PMID: 25458897
Bmpr2 and Acvr2a normally play cell-type-specific, necessary roles in organelle biogenesis and the shutdown of developmental programs and cell division. PMID: 22611050
Acvr2a is a Th17 specific gene making Th17 cells distinct from other helper T cells, Th1, Th2, and Treg. PMID: 22056434
stimulates expression of APRIL via the Smad3 and ERK/CREB pathways in macrophages PMID: 21784102
Results demonstrated that BMPRII and ActRII are the functional type II TGF-beta receptors in BMP-9-induced osteogenic differentiation of C3H10T1/2 cells. PMID: 20801928
The coordinated activity of ActRIIA and BMPRII receptor subunits selectively mediates the chemotactic response to BMP7. PMID: 20011660
Activin type IIB(ActRIIB) and its subfamily receptor, Activin type IIA (ActRIIA), cooperatively mediate the Gdf11 signal in patterning the axial vertebrae PMID: 12414726
analysis of expression and cellular compartmentalization of the activin receptors ActRIIA, ActRIIB and ActRIB, the inhibin co-receptor (betaglycan), and activin signaling proteins Smads 2, 3 and 4, and growth regulatory role during lactation PMID: 12782414
Data suggest that activin receptor II signaling is critical only for follicle-stimulating hormone homeostasis and not for gonadotrophin-releasing hormone (GnRH)biosynthesis or induction of pituitary GnRH receptor expression. PMID: 14654247
Overexpression of ARIP2 enhances endocytosis of ActRIIAs; data indicate that ARIP2 is a novel factor regulating cell surface ActRIIA expression and activin function. PMID: 15451561
loss of Bmpr2 leads to the net gain of signaling by some, but not all, BMP ligands via the activation of ActRIIa PMID: 15883158
ActRIIa is expressed in the early development of thymocytes. PMID: 16477644
RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and that increased utilization of ActRIIA leads to generation of an enhanced BMP signal PMID: 17472960

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily

Tissue Specificity

Brain, testis, intestine, liver and kidney.

Database Links

KEGG: mmu:11480

STRING: 10090.ENSMUSP00000067305

UniGene: Mm.314338

Code	CSB-MP001260MO1
Abbreviation	Recombinant Mouse ACVR2A protein, partial (Active)
MSDS	MSDS Datasheet
Size	$114
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2a at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC₅₀ is 1.562-1.966 ng/mL. Biological Activity Assay The purity of ACVR2A was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage