Recombinant Mouse Activin receptor type-2A (Acvr2a), partial (Active)

In Stock
Code CSB-MP001260MO1
MSDS
Size $114
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2a at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 1.562-1.966 ng/mL. Biological Activity Assay
  • The purity of ACVR2A was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse ACVR2A at 2 μg/mL can bind Anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU). The EC50 is 1.562-1.966 ng/mL.
Target Names
Uniprot No.
Alternative Names
Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA); Acvr2a; Acvr2
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
20-135aa
Target Protein Sequence
AILGRSETQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Mol. Weight
14.8 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant mouse ACVR2A protein is expressed in mammalian cells with ten C-terminal His-tags. Its expression region encodes the Ala20-Pro135 of the mouse ACVR2A protein. Its purity is over 95% as determined by SDS-PAGE and SEC-HPLC. It is an active protein as validated in a functional ELISA where immobilized mouse ACVR2A at 2 μg/mL can bind the anti-ACVR2A recombinant antibody (CSB-RA623829MA1HU), with the EC50 of 1.562-1.966 ng/mL.

The mouse ACVR2A protein, a member of the activin receptor family, plays a multifaceted role in various biological processes, including apoptosis, immune response, and development. ACVR2A functions primarily as a transmembrane receptor that mediates signal transduction pathways initiated by activins, which are involved in numerous physiological and pathological processes.

One significant role of ACVR2A is its involvement in apoptosis regulation. Research indicates that ACVR2A is targeted by microRNA-21, leading to its downregulation in asthmatic models. This downregulation is reversed upon treatment with mesenchymal stem cells (MSCs), which suggests that ACVR2A has protective effects against cell injury, particularly in bronchial epithelial cells [1]. The anti-apoptotic role of ACVR2A is further supported by findings that its expression levels correlate with the recovery of injured cells, indicating its importance in cell survival mechanisms [1].

In the context of cancer, ACVR2A has been implicated in tumor progression and metastasis. Studies have shown that mutations in the ACVR2A gene can lead to a loss of function, which is associated with increased metastatic potential in colorectal cancer [2][3]. Specifically, ACVR2A inhibits bone morphogenetic protein (BMP) signaling, which is known to promote cancer cell migration and invasion. This suggests that ACVR2A acts as a tumor suppressor by regulating pathways that control cell proliferation and migration [2][3]. Furthermore, its downregulation has been linked to poor prognosis in various cancers, highlighting its critical role in tumor biology [2].

ACVR2A also plays a crucial role in developmental processes. In mouse models, ACVR2A is essential for craniofacial development, where it is involved in maintaining cell viability and proper patterning of cranial structures [4]. The ACVR2A-mediated signaling pathways are vital for the differentiation and function of various cell types during embryogenesis and tissue development [5]. Additionally, ACVR2A's interaction with other receptors, such as ACVR2B, is necessary for normal bone formation and homeostasis, further emphasizing its importance in developmental biology [6]. Moreover, ACVR2A has been shown to modulate immune responses. In liver fibrosis models, the blockade of ACVR2A signaling has been associated with reduced activation of hepatic stellate cells, indicating its role in regulating inflammatory responses within the liver [7].

References:
[1] C. Li, Z. Xu, X. Fan, H. Chen, Q. Yu, S. Fang, et al. Microrna-21 mediates the protective effects of mesenchymal stem cells derived from ipscs to human bronchial epithelial cell injury under hypoxia, Cell Transplantation, vol. 27, no. 3, p. 571-583, 2018. https://doi.org/10.1177/0963689718767159
[2] C. Zhuo, D. Hu, J. Li, H. Yu, X. Lin, Y. Chen, et al. Downregulation of activin a receptor type 2a is associated with metastatic potential and poor prognosis of colon cancer, Journal of Cancer, vol. 9, no. 19, p. 3626-3633, 2018. https://doi.org/10.7150/jca.26790
[3] J. Wang. Identification of 8 candidate microsatellite instability loci in colorectal cancer and validation of the acvr2a mechanism in the tumor progression, Scientific Reports, vol. 14, no. 1, 2024. https://doi.org/10.1038/s41598-024-62753-1
[4] R. Albertson, T. Payne-Ferreira, J. Postlethwait, & P. Yelick. Zebrafish acvr2a and acvr2b exhibit distinct roles in craniofacial development, Developmental Dynamics, vol. 233, no. 4, p. 1405-1418, 2005. https://doi.org/10.1002/dvdy.20480
[5] A. Weiß and L. Attisano. The tgfbeta superfamily signaling pathway, Wiley Interdisciplinary Reviews Developmental Biology, vol. 2, no. 1, p. 47-63, 2012. https://doi.org/10.1002/wdev.86
[6] M. Zhao, S. Harris, D. Horn, Z. Geng, R. Nishimura, G. Mundy, et al. Bone morphogenetic protein receptor signaling is necessary for normal murine postnatal bone formation, The Journal of Cell Biology, vol. 157, no. 6, p. 1049-1060, 2002. https://doi.org/10.1083/jcb.200109012
[7] H. Zhou, B. Ju, Y. Nie, B. Song, Y. Xu, & P. Gao. Adenovirus‑mediated knockdown of activin a receptor type�2a attenuates immune‑induced hepatic fibrosis in mice and inhibits interleukin‑17‑induced activation of primary hepatic stellate cells, International Journal of Molecular Medicine, 2018. https://doi.org/10.3892/ijmm.2018.3600

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.
Gene References into Functions
  1. Activation of ActRIIA signaling during early chronic kidney disease contributes to the CKD-MBD components of osteodystrophy and cardiovascular disease and to renal fibrosis. PMID: 28843411
  2. blocking activin/ACVR2A impaired the potency of hepatic stellate cells to produce collagens in response to IL17s. PMID: 29620144
  3. Anti-ActRII blockade is an effective intervention against cancer cachexia providing benefit even in the presence of anti-cancer therapies. PMID: 27462398
  4. Data, including data from studies using transgenic mice, suggest that osteoblasts deficient in Acvr2A exhibit un-characteristic features; osteoclasts deficient in Acvr2A or Acvr2B or both appear normal. Acvr2A-deficient mice exhibit significantly increased femoral trabecular bone volume at 6 weeks of age; Acvr2B-deficient mice exhibit no significant change in any bone parameter. PMID: 28659341
  5. miR-125b regulated the activin/Smad2 signaling in neonatal mouse ovary by directly targeting the 3'-untranslated region of activin receptor type 2a PMID: 26962113
  6. Our study shows that a miR-590/Acvr2a/Rad51b signaling axis ensures the stabilization of mESCs by balancing DNA damage repair and rapid proliferation during self-renewal. PMID: 25458897
  7. Bmpr2 and Acvr2a normally play cell-type-specific, necessary roles in organelle biogenesis and the shutdown of developmental programs and cell division. PMID: 22611050
  8. Acvr2a is a Th17 specific gene making Th17 cells distinct from other helper T cells, Th1, Th2, and Treg. PMID: 22056434
  9. stimulates expression of APRIL via the Smad3 and ERK/CREB pathways in macrophages PMID: 21784102
  10. Results demonstrated that BMPRII and ActRII are the functional type II TGF-beta receptors in BMP-9-induced osteogenic differentiation of C3H10T1/2 cells. PMID: 20801928
  11. The coordinated activity of ActRIIA and BMPRII receptor subunits selectively mediates the chemotactic response to BMP7. PMID: 20011660
  12. Activin type IIB(ActRIIB) and its subfamily receptor, Activin type IIA (ActRIIA), cooperatively mediate the Gdf11 signal in patterning the axial vertebrae PMID: 12414726
  13. analysis of expression and cellular compartmentalization of the activin receptors ActRIIA, ActRIIB and ActRIB, the inhibin co-receptor (betaglycan), and activin signaling proteins Smads 2, 3 and 4, and growth regulatory role during lactation PMID: 12782414
  14. Data suggest that activin receptor II signaling is critical only for follicle-stimulating hormone homeostasis and not for gonadotrophin-releasing hormone (GnRH)biosynthesis or induction of pituitary GnRH receptor expression. PMID: 14654247
  15. Overexpression of ARIP2 enhances endocytosis of ActRIIAs; data indicate that ARIP2 is a novel factor regulating cell surface ActRIIA expression and activin function. PMID: 15451561
  16. loss of Bmpr2 leads to the net gain of signaling by some, but not all, BMP ligands via the activation of ActRIIa PMID: 15883158
  17. ActRIIa is expressed in the early development of thymocytes. PMID: 16477644
  18. RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and that increased utilization of ActRIIA leads to generation of an enhanced BMP signal PMID: 17472960

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Tissue Specificity
Brain, testis, intestine, liver and kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*