Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
Alternative Names
Shh; Hhg1; Sonic hedgehog protein; SHH; HHG-1; Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains; ShhNC) [Cleaved into: Sonic hedgehog protein N-product; ShhN; Shh N-terminal processed signaling domains; ShhNp; Sonic hedgehog protein 19 kDa product)]
Species
Mus musculus (Mouse)
Expression Region
25-198aa
Complete Sequence
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Dive into cancer research with Recombinant Mouse Sonic Hedgehog Protein (Shh), a key component in the Hedgehog signaling pathway involved in embryonic development and tumorigenesis. This partial protein, expressed in E. coli, covers the 25-198aa region of Shh and is provided tag-free. With a purity of over 95%, as verified by SDS-PAGE, and endotoxin levels below 1.0 EU/µg, this lyophilized powder is suitable for a range of research applications. The functional ELISA activity demonstrates an ED50 of less than 90 µg/ml in its ability to bind Human BOC, supporting the protein's high level of biological activity.