Recombinant Mouse Sonic hedgehog protein(Shh),partial (Active)

In Stock
Code CSB-AP005791MO
Product Type Other
Size $137Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q62226
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4
Alias Sonic Hedgehog Protein; SHH; HHG-1; SHH
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Research Area Cancer
Source E.coli
Gene Names Shh
Expression Region 25-198aa
Tag Info Tag-Free
Mol. Weight 19.8 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Sonic hedgehog protein
Subcellular Location Sonic hedgehog protein N-product: Cell membrane, Lipid-anchor
Protein Families Hedgehog family
Tissue Specificity Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.
Database Links

KEGG: mmu:20423

STRING: 10090.ENSMUSP00000002708

UniGene: Mm.57202

Pathway Hedgehog signaling pathway

Related Products

Shh Antibodies

Shh Antibodies for Mus musculus (Mouse)

Shh Proteins

Shh Proteins for Mus musculus (Mouse)

Shh ELISA Kit

Shh ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.