Recombinant Bovine Odorant-binding protein

Code CSB-MP362133BO
Size US$1848
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Uniprot No. P07435
Research Area Others
Species Bos taurus (Bovine)
Source Mammalian cell
Expression Region 1-159aa
Target Protein Sequence AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 22.0 kDa
Protein Length Full Length
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
Buffer before Lyophilization Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Target Data

Function This protein binds a wide variety of chemical odorants.
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Database Links

STRING: 9913.ENSBTAP00000022593

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.