Recombinant Bovine Interleukin-10(IL10)

Code CSB-YP011580BO
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names IL10
Uniprot No. P43480
Research Area Others
Alternative Names IL10Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF
Species Bos taurus (Bovine)
Source Yeast
Expression Region 19-178aa
Target Protein Sequence SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 20.6kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Gene References into Functions
  1. Studied expression of Interleukin 10 (IL-10) in blood and milk samples of 25 healthy and 25 mastitic cows. Found IL-10 expression to be significantly higher in the blood and milk samples of mastitic cows compared to the healthy ones. PMID: 28267404
  2. This study seems to indicate that PGE2 in cattle does not produce an anti-inflammatory effect by increasing the synthesis of IL-10. PMID: 25286662
  3. IL-10 mRNA expression increased on day 8 in the mononuclear leukocytes of pregnant cows. In a cell culture experiment, interferon-tau stimulated stimulated IL-10 mRNA expression in mononuclear leukocytes. PMID: 22052007
  4. Bovine IL-10 potently inhibits the activation of human myeloid cells in response to toll like receptor activation. PMID: 21464967
  5. Levels in milk are altered in the presence of bacteria. PMID: 15372997
  6. Monocytes obtained from cows with subclinical infection with MAP had upregulated expression of IL-10 and SOCS-3, which may have attenuated the capacity of mononuclear phagocytes to initiate inflammatory and adaptive immune responses. PMID: 16111147

Show More

Hide All

Subcellular Location Secreted
Protein Families IL-10 family
Database Links

KEGG: bta:281246

STRING: 9913.ENSBTAP00000008793

UniGene: Bt.4723

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1