Recombinant Bovine Interleukin-10(IL10)

Code CSB-YP011580BO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P43480
Relevance Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cytokine synthesis inhibitory factor ;CSIF
Species Bos taurus (Bovine)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
Research Area Others
Source Yeast
Gene Names IL10
Protein Names Recommended name: Interleukin-10 Short name= IL-10 Alternative name(s): Cytokine synthesis inhibitory factor Short name= CSIF
Expression Region 19-178aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 20.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular Location Secreted
Protein Families IL-10 family
Database Links

KEGG: bta:281246

STRING: 9913.ENSBTAP00000008793

UniGene: Bt.4723

Pathway Jak-STAT signaling pathway
T cell receptor signaling pathway
FoxO signaling pathway

Related Products

IL10 Antibodies

IL10 Antibodies for Bos taurus (Bovine)

IL10 Proteins

IL10 Proteins for Bos taurus (Bovine)

IL10 ELISA Kit

IL10 ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.