Recombinant Bovine Interleukin-10(IL10)

Code CSB-EP011580BO
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP011580BO-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP011580BO
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP011580BO
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names IL10
Uniprot No. P43480
Research Area Others
Alternative Names IL10Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF
Species Bos taurus (Bovine)
Expression Region 19-178aa
Target Protein Sequence SRDASTLSDSSCIHLPTSLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
Mol. Weight 20.6kD
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Gene References into Functions
  1. Studied expression of Interleukin 10 (IL-10) in blood and milk samples of 25 healthy and 25 mastitic cows. Found IL-10 expression to be significantly higher in the blood and milk samples of mastitic cows compared to the healthy ones. PMID: 28267404
  2. This study seems to indicate that PGE2 in cattle does not produce an anti-inflammatory effect by increasing the synthesis of IL-10. PMID: 25286662
  3. IL-10 mRNA expression increased on day 8 in the mononuclear leukocytes of pregnant cows. In a cell culture experiment, interferon-tau stimulated stimulated IL-10 mRNA expression in mononuclear leukocytes. PMID: 22052007
  4. Bovine IL-10 potently inhibits the activation of human myeloid cells in response to toll like receptor activation. PMID: 21464967
  5. Levels in milk are altered in the presence of bacteria. PMID: 15372997
  6. Monocytes obtained from cows with subclinical infection with MAP had upregulated expression of IL-10 and SOCS-3, which may have attenuated the capacity of mononuclear phagocytes to initiate inflammatory and adaptive immune responses. PMID: 16111147

Show More

Hide All

Subcellular Location Secreted
Protein Families IL-10 family
Database Links

KEGG: bta:281246

STRING: 9913.ENSBTAP00000008793

UniGene: Bt.4723

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1