Home
Protein
Recombinant Proteins
Recombinant Helicobacter pylori Urease subunit alpha (ureA)

Recombinant Helicobacter pylori Urease subunit alpha (ureA)

^{In Stock}

Code	CSB-EP320452HUV
Abbreviation	Recombinant Helicobacter pylori ureA protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ureA

Uniprot No.

P14916

Research Area

Others

Alternative Names

ureA; hpuA; HP_0073; Urease subunit alpha; EC 3.5.1.5; Urea amidohydrolase subunit alpha

Species

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Source

E.coli

Expression Region

1-238aa

Target Protein Sequence

MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

30.5 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The synthesis of Recombinant H.pylori ureA protein began with the isolation of ureA gene from the native genome. The next step was to amplify the ureA gene by inserting the ureA gene into an expression vector and then introducing the vector into the selected host cell, E.coli. Significant amounts of recombinant H.pylori ureA protein were produced by the host only when expression genes were added. For the purpose of protein purification, the vector contains N-terminal 6xHis tag to the ureA DNA sequence. The purity of this protein is 85%+ determined by SDS-PAGE.

ureA (also known as hpuA) is a gene encoding a protein named urease subunit alpha (ureA) in Helicobacter pylori. The protein encoded by this gene is also known as urea amidohydrolase subunit alpha and belongs to urease gamma subunit family and urease beta subunit family. Its orthologous protein is known as the gamma/beta subunit (UreAB) in most other bacteria. This protein plays an important role in urea catabolic process.