Recombinant Helicobacter pylori Urease subunit alpha (ureA)

In Stock
Code CSB-EP320452HUV
Abbreviation Recombinant Helicobacter pylori ureA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
ureA
Uniprot No.
Research Area
Others
Alternative Names
ureA; hpuA; HP_0073; Urease subunit alpha; EC 3.5.1.5; Urea amidohydrolase subunit alpha
Species
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Source
E.coli
Expression Region
1-238aa
Target Protein Sequence
MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The synthesis of Recombinant H.pylori ureA protein began with the isolation of ureA gene from the native genome. The next step was to amplify the ureA gene by inserting the ureA gene into an expression vector and then introducing the vector into the selected host cell, E.coli. Significant amounts of recombinant H.pylori ureA protein were produced by the host only when expression genes were added. For the purpose of protein purification, the vector contains N-terminal 6xHis tag to the ureA DNA sequence. The purity of this protein is 85%+ determined by SDS-PAGE.

ureA (also known as hpuA) is a gene encoding a protein named urease subunit alpha (ureA) in Helicobacter pylori. The protein encoded by this gene is also known as urea amidohydrolase subunit alpha and belongs to urease gamma subunit family and urease beta subunit family. Its orthologous protein is known as the gamma/beta subunit (UreAB) in most other bacteria. This protein plays an important role in urea catabolic process.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ammonia produced by ureolysis increases the gastric pH thereby providing an environment permissive for colonization of the stomach.
Subcellular Location
Cytoplasm. Note=Also associates with the outer membrane upon autolysis of neighboring bacteria.
Protein Families
Urease gamma subunit family; Urease beta subunit family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*