Recombinant Human Angiopoietin-1 (ANGPT1), partial

In Stock
Code CSB-MP622996HU1
Abbreviation Recombinant Human ANGPT1 protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
ANG-1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
277-498aa
Target Protein Sequence
REEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme.
Gene References into Functions
  1. ERG is an endothelial transcriptional effector activated downstream of Ang1 to promote Notch signalling and vascular stability. Ang1 is able to phosphorylate ERG via PI3K/Akt, and this promotes the formation of an ERG-beta catenin complex, which binds multiple sites in the Dll4 locus and drives Dll4 expression. PMID: 28695891
  2. miR-876-5p suppressed proliferation by restraining the expression of Ang-1, which would regulate the phosphorylation level of PI3K, AKT, mTOR and ERK in psoriasic cells. PMID: 29864894
  3. hyperoxia as well as increased TGFbeta signaling is a major contributor to the increased levels of miR34a, which mediate injury via angiopoietin-1 in neonatal lungs PMID: 29079808
  4. High Angpt2 and low Angpt1 levels were positively associated with abnormal cardiac structure. PMID: 27991547
  5. findings reveal a novel role for miR-204/ANGPT1/TGFbetaR2 axis in tumor angiogenesis. We propose that therapeutic manipulation of miR-204 levels may represent a promising approach in breast cancer. PMID: 27703260
  6. VEGF plays a role in the induction of of ANGPT1 in skeletal muscle to stimulate angiogenesis. PMID: 29517203
  7. no significant difference in liver expression between chronic hepatitis C patients and controls PMID: 28027429
  8. serum Ang-2 and Ang-1 levels may help in the diagnosis of patients with lymphatic anomalies and are concordant to sirolimus response. PMID: 27990590
  9. Studied role of change in ratio of angiopoietin-2 (Ang-2) to angiopoietin-1 (Ang-1) levels in hantavirus ionfections. Found imbalance in ang-2:ang-1 lasted through the acute infection phase. PMID: 28734140
  10. Bicarbonate buffered PD fluid promotes vessel maturation via upregulation of angiopoietin-1 in vitro and in children on dialysis PMID: 29253861
  11. When Tie2 becomes inactivated, important molecular brakes are released in the endothelium, which in turn potentiate inflammation and vascular leakage. The ligands of Tie2, Angiopoietin-1 and Angiopoietin-2, regulate its activation status. PMID: 28582314
  12. These data suggest that certain DCE-MRI parameters correlate with R-ISS and adverse prognostic features of angiogenesis, such as the ratio of Angp-1/Angp-2. PMID: 28766001
  13. study revealed decreased levels of VEGF, ANGPT1, and MMP-9 in the early post-transplant period as compared to the baseline (BC). ANGPT2 was decreased after conditioning treatment, but tended to increase from day +7. On day +7, positive correlations between ANGPT1 level as well as MMP-9 and the time to engraftment were observed. PMID: 28956132
  14. These results indicate that the Angpt-Tie2 system is essential for SC integrity. The impairment of this system underlies POAG-associated pathogenesis, supporting the possibility that Tie2 agonists could be a therapeutic option for glaucoma. PMID: 28920924
  15. Ang-1 specifically increases circulating Gr1(+ )inflammatory monocytes and increases monocyte/macrophage retention in atherosclerotic plaques, thereby contributing to development of atherosclerosis. PMID: 28069704
  16. NOX2, NOX4, and mitochondrial-derived reactive oxygen species contribute to angiopoietin-1 signaling and angiogenic responses in endothelial cells. PMID: 28351775
  17. ANG-1, ANG-2 and TIE-2 levels were significantly increased in placenta of non-complicated ART pregnancies compared to placentas from spontaneous conception. PMID: 28238760
  18. study is the first one to report Ang1 capacity to induce MIP-1beta gene expression, protein synthesis and release from neutrophils, and that these effects are mediated by PI3K, p38 MAPK and MEK activation and downstream NF-kappaB activation PMID: 27632174
  19. In this study, we found that angiopoietins and Tie receptors were highly expressed in cervical cancer cells. Tie-2 expression in tumor cells predicted poorer prognosis.Our data support that dual inhibition of Ang-1 and Ang-2 may be an alternative target for anti-angiogenic adjuvant therapy in advanced or recurrent cervical squamous cell cancer. PMID: 28720059
  20. Data show that fibulin-5 strongly binds to the endothelial cell surface reducing endothelial cell viability and interfering with the signaling pathways of the Ang-1/TIE-2 receptor axis. PMID: 27304216
  21. Ang-1 is not a predictive and clinically relevant biomarker in pulmonary hypertension PMID: 27802345
  22. We could therefore conclude that angiogenesis is an important event in the development of common skin warts, and the upregulation of both Ang1 and -2 and their binding receptor Tie2 may play a role in the angiogenesis associated with the development of these lesions. PMID: 26695562
  23. In vitro binding assays with purified components reveal that Tie-integrin recognition is direct, and further demonstrate that the receptor binding domain of the Tie2 ligand Ang-1, but not the receptor binding domain of Ang-2, can independently associate with a5b1 or aVb3. cooperative Tie/integrin interactions selectively stimulate ERK/MAPK signaling in the presence of both Ang-1 and fibronectin PMID: 27695111
  24. Results uncovered ZO-1 as part of a signaling node activated by VEGF, but not Ang-1, that specifically modulates endothelial cells proliferation during angiogenesis. PMID: 26846344
  25. there was no immunohistochemical evidence for apoptosis or autophagy. Quantitative staining showed similar expression levels of the angiogenesis regulators VEGF-A, VEGF-receptor 2 and Angpt1 (p = 0.11), but Angpt2 was significantly lower in CKD children (p = 0.01). PMID: 27846250
  26. Ang-1 and -2 levels and the Ang-2/Ang-1 ratio may be promising indicators of disease activity in hemolytic uremic syndrome induced by enterohemorrhagic Escherichia coli. PMID: 26945868
  27. l-thyroxine increased Ang1 expression and induces bone formation, differentiation, and mineralization in U2OS and MG63 cell lines. PMID: 27569283
  28. Hydroxysafflor yellow A promotes angiogenesis in HUVEC cells via the angiopoietin 1/ Tie-2 signaling pathway. PMID: 27894114
  29. We conclude that aging shifts the balance of the Ang1/Ang2 network favouring a quiescent state. Activation of endothelial cells in aging might be necessary to enhance wound healing capacities. PMID: 27137842
  30. Plasma Ang-1 levels were diminished in Behcet's disease patients, especially in patients with vascular involvement. PMID: 25964071
  31. Ang2/Ang1 ratio might constitute a useful tool for monitoring the progression of chronic liver disease towards cirrhosis and play an important role as therapeutic target. PMID: 27956798
  32. Data suggest that ANGPT1 is active in tight junctions and adherens junctions in the up-regulation of pathophysiological angiogenesis in ovarian follicles in ovarian hyperstimulation syndrome. Follicular fluid from women at risk of ovarian hyperstimulation syndrome in Argentina was used in these studies. PMID: 25485810
  33. the results of the present study suggest that aHSCs increased the expression of Ang-1, resulting in angiogenesis in HCC tissues, thus promoting the growth and metastasis of HCC. PMID: 27358066
  34. Results found that MCT contributes to endothelial cell growth and tube formation via up-regulation of angiopoietin-1 expression suggesting that MCT plays an important role in pancreatic cancer angiogenesis and tumor growth via activating the angiopoietin-1 pathway. PMID: 27240355
  35. Angiopoietin 1 levels were significantly higher in nasopharyngeal cancer patients. PMID: 26758427
  36. High Ang 1 expression in hilar cholangiocarcinoma and infiltration of TIE2-expressing monocytes (TEMs) defines a subgroup of patients with beneficial tumor characteristics and prolonged survival. Low Ang 2 levels tended to inversely correlate with TEMs invasion. PMID: 27111031
  37. GTPCH/Ang-1 interaction in stromal fibroblasts and activation of Tie2 on breast tumor cells could play an important role in supporting breast cancer growth. PMID: 26814432
  38. the homeostasis of vascular endothelial function by Ang-1 and Ang-2 is disrupted in macrophage activation syndrome (MAS); the Ang-2/1 ratio was significantly elevated in the active phase of s-JIA; serum Ang-1 levels were significantly decreased in MAS, whereas the serum Ang-2 levels and the Ang-2/1 ratio were significantly elevated in MAS PMID: 26908294
  39. ANGPT1 may be associated with taxol resistance of nasopharyngeal carcinoma cells. PMID: 26722421
  40. ANGPT1, ANGPT2, and VEGF are associated with development of acute graft-versus-host disease after allogeneic hematopoietic stem cell transplantation. PMID: 26489624
  41. AGP1 is downregulated in non-small cell lung cancer patients compared to those with benign lung disease or no lung disease. PMID: 26908325
  42. In this study found that serum Ang-1 levels were significantly higher at 72 hours post-hemorrhage among aSAH patients. PMID: 26208799
  43. For the diagnosis of HELLP syndrome, increased levels of ET-1,M30 and Angs-1 [Angiopoietin-1] and -2 [Angiopoietin-2]appear as promising biomarkers after determination of their standardized threshold levels PMID: 26138305
  44. H3K9 demethylase KDM3B represses transcription of the angiogenesis regulatory gene, ANGPT1. PMID: 25413303
  45. Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin PMID: 26090670
  46. Genetic variations of ANGPT1 were associated with increased infarct size and disease susceptibility. PMID: 26542693
  47. The distribution of the other genotypes (rs2507800, rs1954727 and rs1010824 of ANGPT1 was not significantly different between patients with psoriasis vulgaris and the healthy controls. PMID: 25753570
  48. Malaria in pregnancy is an effect modifier of the association between Ang-1 and placental barrier thickness. PMID: 26090803
  49. Ang-1 disrupts TLR4 signalling, resulting in inhibition of LPS-induced inflammatory responses in endothelial cells. This inhibition occurs through selective targeting of IRAK1 and TRAF6 proteins by miR-146b-5p. PMID: 25824148
  50. Gingipains from the Porphyromonas gingivalis play roles in regulation of angiopoietin 1 and angiopoietin 2 in human aortic smooth muscle cells. PMID: 26283334

Show More

Hide All

Subcellular Location
Secreted.
Database Links

HGNC: 484

OMIM: 601667

KEGG: hsa:284

STRING: 9606.ENSP00000428340

UniGene: Hs.369675

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*