Recombinant Human Apoptosis-inducing factor 1, mitochondrial (AIFM1), partial

In Stock Promotion
Code CSB-EP001492HU
Abbreviation Recombinant Human AIFM1 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Apoptosis
Alternative Names
AIFM1; AIFM1_HUMAN; Apoptosis inducing factor 1, mitochondrial; Apoptosis inducing factor; Apoptosis inducing factor, mitochondrion associated, 1; Apoptosis-inducing factor 1; CMTX4; COWCK; COXPD6; Harlequin; Hq; mAIF; MGC111425; MGC5706; mitochondrial; Neuropathy, axonal motor-sensory, with deafness and mental retardation; neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome); PDCD 8; PDCD8; Programmed cell death 8 (apoptosis inducing factor); Programmed cell death 8; Programmed cell death 8 isoform 1; Programmed cell death 8 isoform 2; Programmed cell death 8 isoform 3; Programmed cell death protein 8; Programmed cell death protein 8 mitochondrial; Programmed cell death protein 8 mitochondrial precursor; Programmed cell death protein 8 mitochondrial precursor; Striatal apoptosis inducing factor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
103-612aa
Target Protein Sequence
GLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
71.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Binds to DNA in a sequence-independent manner. Interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates caspase-7 to amplify apoptosis. Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. In contrast, participates in normal mitochondrial metabolism. Plays an important role in the regulation of respiratory chain biogenesis by interacting with CHCHD4 and controlling CHCHD4 mitochondrial import.; Has NADH oxidoreductase activity. Does not induce nuclear apoptosis.; Pro-apoptotic isoform.
Gene References into Functions
  1. Here, the binding site of AIF(Delta1-121) and AIF(370-394) on CypA has been mapped by NMR spectroscopy and biochemical studies, and a molecular model of the complex has been proposed. The authors show that AIF(370-394) interacts with CypA on the same surface recognized by AIF(Delta1-121) protein and that the region is very close to the CypA catalytic pocket. PMID: 28442737
  2. new form of motor neuropathy expands the phenotypic spectrum of AIFM1 mutations and therefore, the AIFM1 gene should be considered in the diagnosis of hereditary motor neuropathies PMID: 28975462
  3. X-linked hypomyelination with spondylometaphyseal dysplasia associated with mutations in AIFM1 PMID: 28842795
  4. report of a family carrying a novel missense mutation in AIFM1 that exhibits an isolated axonal polyneuropathy with misassembly of mitochondrial complex I and III. PMID: 28888069
  5. we sought to investigate mechanisms mediated by Hsp70 acetylation in relation to apoptotic and autophagic programmed cell death. Upon stress-induced apoptosis, Hsp70 acetylation inhibits apoptotic cell death, mediated by Hsp70 association with apoptotic protease-activating factor (Apaf)-1 and apoptosis-inducing factor (AIF), key modulators of caspase-dependent and -independent apoptotic pathways, respectively PMID: 28627586
  6. Overexpression of full-length AIFM1 suppresses proliferation and induces apoptosis of HepG2 and Hep3B cells. Caspase 3 and DRAM are involved in full-length AIFM1-induced apoptosis in HepG2 and Hep3B cells. PMID: 29501488
  7. Real-time PCR results showed that apoptosis-inducing factor (AIF) and calpain-1 mRNAs were highly expressed in the transitional segmentof the Hirschsprung's disease bowel, whereas autophagy protein 5 (Atg5) was highly expressed in the narrow segment. Western blot results were consistent with mRNA levels, with increased AIF, calpain-1, and Atg5 expressions in the transitional segment compared with the dilated segment. PMID: 28562483
  8. Data revealed that under a nutrient deficient condition, CD317 functions as an anti-apoptotic factor through AIF-mediated caspase and autophagy-independent manner. PMID: 27444183
  9. we report that AIF-independent PARP-1-dependent necrosis constitutes a major mechanism of RPE cell death leading to retinal degeneration in dry age-related macular degeneration . PMID: 28055012
  10. Downregulation of AIF by hypoxia causes oxidative inactivation of the lipid phosphatase activity of phosphatase and tensin homolog on chromosome 10 (PTEN), with ensuing activation of Akt kinase, phosphorylation of the Akt substrate GSK-3beta and activation of WNT/beta-catenin signaling in colon cancer cells. PMID: 27543779
  11. novel pathway for mda-7/IL-24-induced caspase-independent apoptosis in neuroblastoma cells mediated through modulation of AIF, ATM, and gamma-H2AX. PMID: 27197168
  12. Study defines the mechanism whereby AIF is allosterically modulated by charge-complex formation with NADH. Two distinct molecular pathways couple AIF's active site to dimerization and release of its regulatory C-loop insert with implications for AIF allosteric switching in cell survival and death. PMID: 27818101
  13. Whole exome sequencing indicated a single plausible candidate - the p.Asp237Gly variant in apoptosis inducing factor mitochondria associated 1 (AIFM1; chr. Xq26.1), and the p.Asp237Gly segregated with disease in two families. PMID: 27102849
  14. Only a drastic decrease in the expression level or/and redox activity of AIF tends to cause an early and severe neurodegeneration, whereas less pronounced changes in the AIF properties could lead to a broad range of slowly progressive neurological disorders. PMID: 27178839
  15. AIF translocation plays a role in influenza-virus-induced apoptosis. PMID: 27853862
  16. Copper induces the activation of apoptosis through casp3/casp8/casp9/AIF/TP53 signaling pathways. Suggest that apoptosis activation mechanism is dependent on the concentration, time of exposure to Cu and cell type. PMID: 27046389
  17. Estradiol inhibits oxidative stress-induced accumulation of AIF in nucleolus and PARP1-dependent cell death via estrogen receptor alpha in MCF-7 cells. PMID: 25280774
  18. AIF may participate in but not be dominant in the process of retinal pigment epithelium cell apoptosis induced by oxidative stress. PMID: 27453270
  19. Altogether these data indicate that AIF supports the growth and survival of metabolically defined pancreatic cancer cells and that this metabolic function may derive from a novel mechanism so far undocumented in other cancer types. PMID: 27108222
  20. Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to truncated AIF mediated neuronal cell death progression following neurotoxic stimuli. PMID: 26206088
  21. Results identify PTEN as the substrate of AIF oxidoreductase and reveal a novel function for AIF in controlling tumor metastasis. PMID: 26415504
  22. UDA decreased the St-induced changes in mitochondrial and cytosolic AIF level, whereas in Dox-model it affected only the cytosolic AIF content. PMID: 26012840
  23. strongly support a direct relationship between AIF nuclear translocation and radiation induced cell death in hepatocellular carcinoma cell line HepG2 PMID: 26920061
  24. identification of the novel interaction between Trx1 and AIF has provided opportunities to design and develop therapeutically relevant strategies that either promote or prevent this protein-protein interaction for the treatment of different disease PMID: 26119781
  25. AIF bears a HSP-70 binding domain allowing association with HSP-70. PMID: 26165468
  26. Missense mutations in AIFM1 are associated with X-linked recessive auditory neuropathy spectrum disorder. PMID: 25986071
  27. AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type). PMID: 26063804
  28. Summarizing what is known today, mutations in AIFM1 are associated with a progressive disorder with myopathy, ataxia and neuropathy. PMID: 25583628
  29. These results suggest that AIF downregulation is a common event in kidney tumor development. AIF loss may lead to decreased STK3 activity, defective apoptosis and malignant transformation PMID: 24992339
  30. Residues Regulating the Reductase Activity of the Human Mitochondrial Apoptosis Inducing Factor PMID: 26237213
  31. Data indicate that poptosis-inducing factor (AIF) controls the mitochondrial import of mitochondrial membrane transport protein CHCHD4. PMID: 26004228
  32. review describes the multistep course of parthanatos and its dependence on PAR signalling and nuclear AIF translocation. PMID: 24684389
  33. Increased trophoblast apoptosis and altered expression levels of syncytin-1, calpain 1, and AIF is observed in preeclamptic placentas. PMID: 24413738
  34. Inhibition of the AIF/CypA complex protects against intrinsic death pathways induced by oxidative stress. PMID: 24434516
  35. both the mitochondrial and apoptotic functions of hAIF are interconnected and coenzyme controlled: a key information in the understanding of the physiological role of AIF in the cellular life and death cycle. PMID: 24914854
  36. The E1B-55K or E4orf3 proteins independently prevented nuclear fragmentation subsequent to release of AIF from the mitochondria, possibly by altering the intracellular distribution of PAR-modified proteins. PMID: 24889240
  37. Data show that buthionine sulfoximine and synergizes with hydroxychavicol in inducing apoptosis of chronic myeloid leukemic (CML) cells through the GSH-ROS-JNK-ERK-iNOS pathway by apoptosis inducing factor (AIF)-dependent manner. PMID: 24040019
  38. Aif seems to have pro-apoptotic and anti-apoptotic roles in the same lineage in different contexts and at different stages PMID: 24434313
  39. Bit1 plays pivotal roles in the development and progression of ESCC, and its biological functions in ESCC may be closely associated with AIF and Bcl-2 levels. PMID: 23955799
  40. Apoptosis-inducing factor and leukocyte elastase inhibitor derived DNase II interact and can cooperate to induce cell death. PMID: 23673989
  41. The diarylheptanoid hirsutenone sensitizes chemoresistant ovarian cancer cells to cisplatin via modulation of apoptosis-inducing factor and X-linked inhibitor of apoptosis. PMID: 24247248
  42. the caspase-independent mitochondrial apoptosis factor, apoptosis-inducing factor (AIF) was upregulated following SPG treatment. These findings indicate that SPG exerts its anticancer effects on RC-58T/h/SA#4 primary prostate cancer cells PMID: 23443329
  43. Calpain activation via Ca(2) flux plays an essential role in eliciting an AIF-mediated, caspase-independent apoptotic pathway in EV71-infected cells. PMID: 23515028
  44. AIF knockdown disrupts function of complex I and therefore increases the superoxide production in mitochondria PMID: 23682427
  45. Taken together our results demonstrate that parthenolide causes in the two cell lines a caspase-independent cell death, which is mediated by AIF(apoptosis-inducing factor ). PMID: 22688575
  46. AIF is an important factor for advanced prostate cancer cells and that through control of energy metabolism and redox balance, the enzymatic activity of AIF is critical for this support. PMID: 23118229
  47. Our findings expand the spectrum of AIF-related disease and provide insight into the effects of AIFM1 mutations. PMID: 23217327
  48. We found AIF to be strongly expressed in the villous trophoblast and that small amounts of AIF were localized to the nucleus of the cells. PMID: 22133578
  49. AIF is imported from the endoplasmic reticulum to the mitochondria via mitochondria-associated membranes and transport vesicles. PMID: 22134679
  50. Different mechanisms preserve translation of programmed cell death 8 and JunB in poliovirus-infected endothelial cells. PMID: 22328780

Show More

Hide All

Involvement in disease
Combined oxidative phosphorylation deficiency 6 (COXPD6); Cowchock syndrome (COWCK); Deafness, X-linked, 5 (DFNX5)
Subcellular Location
Mitochondrion intermembrane space. Mitochondrion inner membrane. Cytoplasm. Nucleus. Cytoplasm, perinuclear region.; [Isoform 3]: Mitochondrion intermembrane space. Mitochondrion inner membrane.; [Isoform 4]: Mitochondrion. Cytoplasm, cytosol.; [Isoform 5]: Cytoplasm.
Protein Families
FAD-dependent oxidoreductase family
Tissue Specificity
Expressed in all tested tissues. Detected in muscle and skin fibroblasts (at protein level). Expressed in osteoblasts (at protein level).; [Isoform 3]: Brain specific.; [Isoform 4]: Expressed in all tested tissues except brain.; [Isoform 5]: Isoform 5 is
Database Links

HGNC: 8768

OMIM: 300169

KEGG: hsa:9131

STRING: 9606.ENSP00000287295

UniGene: Hs.424932

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*