Name: Recombinant Human B-cell receptor CD22(CD22),partial (Active)
Brand: CUSABIO
SKU: CSB-MP004900HU

Product Details

Description	The human B-cell receptor CD22 mediates the interactions of the B-cell and the B-cell antigen receptor signaling. It responds to sialylated glycoproteins and can be affected by free sialic acid. Its function is the regulation of cell adhesion, immunoglobulin secretion, and B-cell proliferation. The recombinant protein is the 20-687aa region of the CD22, expressed in mammalian cells. The protein was fused with a 6xHis-tag on the C-terminus, with a molecular weight of 77.9 kDa. SDS-PAGE analysis shows that the product has a purity greater than 95%. As well, it was determined by ELISA that the EC₅₀ was 4.034-4.800 ng/ml for binding to the Anti-CD22 rabbit monoclonal antibody. The final product has low levels of endotoxin, with less than 1.0 EU/µg as determined by the LAL method. The protein can be used on binding and modulation essays; this with the scope to determinate novel antigens presented by IgM, B-cell differentiation, and modulation and immunoglobulin production studies. It can be used as well in cancer research on tumoral antigen response and modulation.
Purity	Greater than 94% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 μg/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml.
Target Names	CD22
Uniprot No.	P20273
Research Area	Cancer
Alternative Names	B cell receptor CD22 precursor; B lymphocyte cell adhesion molecule; B-cell receptor CD22; B-lymphocyte cell adhesion molecule; BL CAM; BL-CAM; BLCAM; CD 22; CD22; CD22 antigen; CD22 molecule; CD22 protein; CD22_HUMAN; Lectin 2; Leu14; Lyb8; MGC130020; sialic acid binding Ig like lectin 2; Sialic acid binding immunoglobulin like lectin 2; Sialic acid-binding Ig-like lectin 2; SIGLEC 2; Siglec-2; SIGLEC2; T cell surface antigen Leu 14; T-cell surface antigen Leu-14
Molecular Characterization
Species	Homo sapiens (Human)
Source	Mammalian cell
Expression Region	20-687aa
Target Protein Sequence	DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
Mol. Weight	77.9 kDa
Protein Length	Partial
Tag Info	C-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
Gene References into Functions	Conjugates of these multivalent ligands with auristatin and saporin toxins are efficiently internalized via hCD22 resulting in killing of B-cell lymphoma cells PMID: 28829594 This is the first time a NMR-based binding study of high affinity Siglec-2 (CD22) ligands in complex with whole Burkitt's lymphoma Daudi cells has been described. PMID: 27808110 Here the authors structurally characterize the ectodomain of CD22 and present its crystal structure with the bound therapeutic antibody epratuzumab, which gives insights into the mechanism of inhibition of B-cell activation. PMID: 28970495 hCD22 transgenic mice develop normal humoral responses in a peanut allergy oral sensitization model. Homing of B cells to Peyer's patches was partially rescued by expression of hCD22 compared with CD22(-/-) B cells, although not to wild-type levels. PMID: 28972089 Diabody-based (177)Lu-radioimmunoconjugate for CD22-directed radioimmunotherapy reduced disease burden in a non-Hodgkin lymphoma mouse model. PMID: 27524505 Siglec-1 and Siglec-2 are potential biomarkers in autoimmune disease. (Review) PMID: 26752092 We aimed to screen exons 9-14 of the CD22 gene, which is a mutational hot spot region in B-precursor acute lymphoblastic leukemia (pre-B ALL) patients. Nine variants, of which two novel, were found. Novel variants were in introns 10 and 13. Gly745Asp (rs10406069) variant was missense and Cys790Arg (rs79438722) variant was silent. PMID: 27486888 Anti-CD22-magnetic nanoparticles-doxorubicin inhibited the proliferation of Raji cells, significantly increased the uptake of doxorubicin, and induced apoptosis. PMID: 26379425 results demonstrate that loss of high affinity CD22 ligands on GC B-cells occurs in both mice and humans through alternative mechanisms, unmasking CD22 relative to naive and memory B-cells PMID: 26507663 MicroRNA-19a and CD22 Comprise a Feedback Loop for B Cell Response in Sepsis. PMID: 26017478 These results suggest that the in vivo mechanism of non-ligand-blocking epratuzumab may, in part, involve the unmasking of CD22 to facilitate the trans-interaction of B cells with vascular endothelium. PMID: 25484043 By using integrative genomics and analysing the relationships of COPD phenotypes with SNPs and gene expression in lung tissue, we identified CST3 and CD22 as potential causal genes for airflow obstruction. PMID: 25182044 study detected the expression of CD22 and CD72 on B cells of myasthenia gravis, compared to multiple sclerosis patient controls and healthy controls y PMID: 23184497 In the absence of functional CD22, B cells have a "hyperactivated" phenotype, CD22 dysfunction could contribute to the pathogenesis of autoimmune diseases. (Review) PMID: 23083346 The finding that CD22 is expressed on lung cancer cells is significant in revealing a heretofore unknown mechanism of tumorigenesis and metastasis PMID: 22986740 Anti-CD22 recombinant immunotoxin moxetumomab pasudotox has activity in relapsed/refractory hairy cell leukemia. PMID: 22355053 Our study implicates the CD22DeltaE12 genetic defect in the aggressive biology of relapsed or therapy-refractory paediatric B-lineage ALL. PMID: 22017452 This CD22-targeted polymer carrier may be useful for siRNA delivery to lymphoma cells. PMID: 21629223 Taken together, these results suggest that negative regulation of TLR signaling of B cells is an intrinsic property of CD22. PMID: 21178327 The efficacy of a ligand-targeting approach to B cell-specific depletion therapy for cancer may be the ability of CD22 to recycle and accumulate ligand-decorated cargo intracellularly, as an endocytic receptor. PMID: 21178016 These striking findings implicate CD22DeltaE12 as a previously undescribed pathogenic mechanism in human B-precursor leukemia. PMID: 20841423 B cell surface receptors CD20 and CD22 are significantly affected in patients with SLE, pointing to their possible involvement in the aetiopathogenesis of the disease and in the regulatory mechanisms in response to the immune disturbance. PMID: 20726320 The B-cell receptor IgM was found to be a major in situ trans ligand of CD22. PMID: 20172905 Data show that anti-CD22 autoantibodies were positive in 80% of TSK/+ mice and in 22% of SSc patients. PMID: 19919568 The Lyn/CD22/SHP-1 pathway is important in autoimmunity. Naive and tolerant B-cells differ in their calcium signaling in response to antigenic stimulation. PMID: 11826756 Disulfide bonds and the resulting 3D conformation of the CD22 molecules may have important roles in the difference of antigenicity of CD22 beta in B cells and basophils PMID: 11882357 ligand-binding of CD22 influences its intracellular signaling domain and is needed for inhibition of the B cell receptor signal PMID: 11994426 masking of the alpha2-6-linked sialic acid binding site of CD22 involves many cell surface sialoglycoproteins, without requiring specific ligand(s) and/or is mediated by secondary interactions with Sias on CD45 and sIgM PMID: 15240561 Aberrant CD22 expression is a useful marker for detection of monoclonal B cells admixed with numerous benign polyclonal B cells PMID: 15899772 decreased CD22 expression may be associated with the activation of B cells in Bullous pemphigoid (BP), but not associated with BP-specific antibody production PMID: 17055225 study showed that a synonymous SNP in CD22, c.2304C > A, was significantly associated with susceptibility to limited cutaneous systemic sclerosis PMID: 17493148 The results suggest that these two siglec proteins have evolved distinct endocytic mechanisms consistent with roles in cell signaling and innate immunity. PMID: 17562860 These results indicate that the alpha2-6-sialylated 6-sulfo-LacNAc determinant serves as an endogenous ligand for human CD22 and suggest the possibility that 6-GlcNAc sulfation as well as alpha2-6-sialylation may regulate Siglec-2 functions in humans. PMID: 17728258 SAP is inducibly expressed in the human BJAB cells, and co-localizes and interacts with CD22. SAP binding to the inhibitory immunoreceptor CD22 regulates calcium mobilization in B cells. PMID: 19150402 Show More Hide All
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Protein Families	Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family
Tissue Specificity	B-lymphocytes.
Database Links	HGNC: 1643 OMIM: 107266 KEGG: hsa:933 STRING: 9606.ENSP00000085219 UniGene: Hs.579691

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-MP004900HU
Size	$428
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 μg/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC₅₀ of human CD22 protein is 4.034-4.800 ng/ml. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human B-cell receptor CD22(CD22),partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage