Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
| Code | CSB-EP004900HU1 |
| Size | $1812 |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | CD22 |
| Uniprot No. | P20273 |
| Research Area | Immunology |
| Alternative Names |
B cell receptor CD22 precursor; B lymphocyte cell adhesion molecule; B-cell receptor CD22; B-lymphocyte cell adhesion molecule; BL CAM; BL-CAM; BLCAM; CD 22; CD22; CD22 antigen; CD22 molecule; CD22 protein; CD22_HUMAN; Lectin 2; Leu14; Lyb8; MGC130020; sialic acid binding Ig like lectin 2; Sialic acid binding immunoglobulin like lectin 2; Sialic acid-binding Ig-like lectin 2; SIGLEC 2; Siglec-2; SIGLEC2; T cell surface antigen Leu 14; T-cell surface antigen Leu-14
|
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 553-672aa |
| Target Protein Sequence | ESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 26.3 kDa |
| Protein Length | Partial |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 13-23 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
|
| Gene References into Functions |
|
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family |
| Tissue Specificity | B-lymphocytes. |
| Database Links |
HGNC: 1643 OMIM: 107266 KEGG: hsa:933 STRING: 9606.ENSP00000085219 UniGene: Hs.579691 |
