Recombinant Human B-lymphocyte antigen CD20(MS4A1),partial

Code CSB-EP015007HU2
Size $1812
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names MS4A1
Uniprot No. P11836
Research Area Cancer
Species Homo sapiens (Human)
Source E.coli
Expression Region 209-297aa
Target Protein Sequence IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 36.9 kDa
Protein Length Partial
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
Gene References into Functions
  1. Our study found that a small subset of papillary thyroid carcinomas (<10%, mainly of classic variant) exhibited aberrant membranous expression of CD20 PMID: 29079175
  2. Our results support the fact that CD200 can be added to routine Chronic lymphoproliferative disorders panel as it is useful in subcategorizing them. However, inclusion of CD20 ABC to routine panel does not seem plausible but may be done for difficult diagnostic cases or where anti-CD20 therapy is planned. PMID: 29567884
  3. showed here that 3' UTR NOTCH1 mutations are associated with low CD20 expression and with relative resistance to anti-CD20 immunotherapy in vitro PMID: 28550186
  4. We conclude that the relationship between complement-regulatory proteins CFHR1 and CFHR3 and response to anti-CD20 mAb therapy varies based on the specific anti-CD20 mAb used. PMID: 27528699
  5. Limiting the antibody-induced induction of immunosuppressive reactive oxygen species may improve the anti-leukemic efficacy of anti-CD20 therapy in chronic lymphocytic leukemia. PMID: 27097113
  6. Case Report: primary cutaneous T-cell lymphoma with aberrant CD20 expression. PMID: 27840885
  7. Data suggest that insulitis (destruction of pancreatic beta-cells and their ability to produce/secrete insulin) occurs in two distinct profiles in type 1 diabetes; these differ in proportion of CD20-positive B-lymphocytes (relative to CD4-positive T-lymphocytes) present within the infiltrate; greater infiltration of CD20-positive B-lymphocytes leads to more aggressive disease progression. PMID: 26858360
  8. PZ-DHA also arrested MDA-MB-231 cell division at the G2/M phase and down-regulated expression of cyclin B1 and cyclin-dependent kinase 1 (CDK1) PMID: 27535497
  9. there is a high CD23a/CD23b ratio of chronic lymphocytic leukemia cells, which demonstrates that in a subset of CLL cases, low CD23 expression together with high CD20 and CD38 expressions may serve as a surrogate for trisomy 12 PMID: 26119874
  10. IL-17-producing pathogenic T lymphocytes co-express CD20 in primary Sjogren's syndrome patients. PMID: 26814615
  11. Studies indicate that CD20 antigen expression is absent in a variety of diffuse large B cell lymphomas (DLBCLs), including plasmablastic lymphoma, primary effusion lymphoma, anaplastic lymphoma, kinase-positive DLBCL, and large B cell lymphoma arising in human herpesvirus 8-associated multicentric Castleman disease. PMID: 26459310
  12. lipid formulations based on a polyplex or lipoplex backbone additionally equipped with anti-CD20 antibodies are promising non-viral vectors for specific oligonucleotide transfer into human tumor cells. PMID: 26585505
  13. The ABC values obtained for CD20 expression levels using PE, APC, or PerCP Cy5.5 are consistent over the five different instrument platforms for any given apparently healthy donor independent of the fluorochrome used PMID: 26013593
  14. Data indicate that Philadelphia chromosome-positive (Ph-positive) acute lymphoblastic leukemia (ALL) patients who presented with cyclin dependent kinase inhibitor 2A/B (CDKN2A/B) deletion showed a higher rate of CD20 antigen expression. PMID: 27090891
  15. the findings demonstrate that treatment with anti-CD20-hIFNalpha reverses resistance of B-NHL PMID: 26398317
  16. Case Report: aberrant CD20 expression by skin-infiltrating T cells using multispectral imaging. PMID: 26381030
  17. Microenvironment CD20 + cells seem to play a favorable prognostic role in classical Hodgkin Lymphoma. Depletion of CD20 + cells together with an increase of TAMs identifies a group of patients with high-risk disease. PMID: 25098425
  18. In conclusion, SNPs of CD20 were not high risk factors of DLBCL, but the T allele of rs2070770 was a potential indicator of superior survival. PMID: 24898664
  19. Characterize premature human NK/T-cell lymphoma cell line with expression of the B-cell marker CD20. PMID: 26299072
  20. Data indicate that CD20 antigen downregulation relies on transcriptional mechanisms in SRC family kinases (SFKs)-dependent transcriptional regulation of CD20. PMID: 25517315
  21. This study identified a novel D393-CD20-derived MHC Class II restricted epitopes that bind various HLA-DR alleles. IFN-gamma-producing D393-CD20 specific CD4 T cell responses were detected in blood lymphocytes from lymphoma patients and D393-CD20 specific CD4 Th1 clones were able to recognize both lymphoma cell lines and autologous lymphoma cells and to induce their apoptosis. PMID: 25449106
  22. Letter/Review: Liver transplant recipients developing CD20-positive lymphoproliferative lesions are significantly older at time of transplantation. PMID: 25394454
  23. CD20 in multiple myeloma without the t(11;14) may have a role in poor prognosis and aberrant expression of Wnt signaling PMID: 24408089
  24. in two cases of mycosis fungoides, CD20 was expressed by a significant population of the neoplastic T-cells, but these T-cells lacked expression of other B-cell markers, including CD79a, CD19 and PAX5. PMID: 24467775
  25. Data indicate that depletion of CD20-expressing T cells may also contribute to the therapeutic effect of rituximab (RTX). PMID: 24928997
  26. Significantly lower rates of CD20 B cells were found in women with placental malaria infections compared with those without such infections. Neither placental malaria infection nor CD20 are associated with low birth weight. PMID: 24245949
  27. Expansion aggregation of CD20+ B cells, HLA-DR expression and arteriolar hyaline thickening influence the outcome of acute cellular rejection in renal allograft. PMID: 23428174
  28. Patients whose percentage of CD20 antigen was above 60.3% had longer treatment-free survival. PMID: 23659384
  29. CD20 protein was aberrantly expressed in T-mycosis fungoides lesions PMID: 24145652
  30. MS4A1/CD20 is responsible for TGF-beta-induced apoptosis of B-cell lymphoma cells. Moreover, downregulation of MS4A1/CD20 by TGF-beta attenuated the effects of the monoclonal anti-MS4A1/CD20 antibody, rituximab, on Ramos cells. PMID: 22665052
  31. Anti-hCD20 IgE antibodies have in vitro cytotoxic activity. PMID: 22692757
  32. Case Report: CD20-positive NK/T-cell lymphoma with an indolent clinical course. PMID: 23031227
  33. CD20 antigen is not expressed in cancer stem cells in multiple myeloma. PMID: 22315496
  34. CD20 expression in B-cell precursor acute lymphoblastic leukemia is common in Mexican patients and lacks a prognostic value. PMID: 22664043
  35. Data indicate that the bridging of CD20 antigen and FcgammaRIIIa is an essential interaction for the initiation of antibody dependent cell-mediated cytotoxicity (ADCC) activity and assay. PMID: 22914441
  36. CD20-positive posttransplant lymphoproliferative disorder lesions in kidney transplant patients are significantly more likely to develop early after transplant and represent an inferior outcome. PMID: 22758374
  37. Data show that in the blood of rheumatoid arthritis (RA) patients, a greater proportion of Th17 cells are of a CD20+ phenotype compared to healthy individuals, suggesting these cells may represent an additional target for anti-CD20 therapies. PMID: 22171710
  38. Prenyltransferases regulate CD20 protein levels and influence anti-CD20 monoclonal antibody-mediated activation of complement-dependent cytotoxicity PMID: 22843692
  39. Dsta show that differential expression of MS4A1 is a stromal signal of uncertain significance, and an example of the rationale for tumor cell enrichment in preparation for gene expression studies to identify markers of particular tumor phenotypes. PMID: 22514692
  40. Report disappointing results after long term treatment of lupus nephritis with anti-CD20 antibody rituximab. PMID: 21258801
  41. B-cell depletion induces transient aggressive behavior in BDC2.5 diabetogenic T cells and reduction in regulatory T (Treg) cell number and function during the B-cell depletion period. PMID: 22490442
  42. Defects in CD20/ B-cell receptors signalosome conformation might predispose to the spectrum of common variable immunodeficiency disorders. PMID: 22130422
  43. Activation of human B cells mediated through two distinct cell surface differentiation antigens, Bp35 and Bp50. PMID: 22517865
  44. Results suggest for the clinical utility of CD20-specific T cells in B cell malignancies. PMID: 21630262
  45. Case Report: obtained good results in 2 high-titer ABO-incompatible living donor kidney transplantation using anti-CD20 and anti-CD25 antibodies without splenectomy, in conjunction with a calcineurin inhibitor plus mycophenolate mofetil or mizoribine. PMID: 21839272
  46. Using protein tomography, different CD20 complexes were found to be associated with the 2 antibodies, and confocal microscopy showed different membrane compartmentalization of these subpopulations of the cellular CD20 pool. PMID: 21444918
  47. The neoplastic epithelial cells in cases of type A and type AB thymoma, as well as few cases of type B1 and B2 thymoma, express CD20. PMID: 21092589
  48. Adoptively T cells transduced anti-CD20scFvFc/CD28/CD3zeta gene mediates enhanced anti-tumor activities against CD20 positive tumor cells, suggesting a potential of gene-based immunotherapy for non-Hodgkin lymphoma. PMID: 20815894
  49. Quantification of CD20 mRNA and protein levels in chronic lymphocytic leukemia suggests a post-transcriptional defect. PMID: 20674973
  50. CD20 immunoexpresion in early rheumatoid arthritis synovium. PMID: 20191119

Show More

Hide All

Involvement in disease Immunodeficiency, common variable, 5 (CVID5)
Subcellular Location Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Protein Families MS4A family
Tissue Specificity Expressed on B-cells.
Database Links

HGNC: 7315

OMIM: 112210

KEGG: hsa:931

STRING: 9606.ENSP00000314620

UniGene: Hs.712553

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1