Recombinant Human Bone morphogenetic protein 7(BMP7)

Code CSB-EP002744HUe0
Product Type Recombinant Protein
Size US$1675
Uniprot No. P18075
Relevance Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Osteogenic protein 1 ;OP-1INN: Eptotermin alfa
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Research Area Developmental Biology
Source E.coli
Gene Names BMP7
Expression Region 293-431aa
Tag Info N-terminal GST-tagged
Mol. Weight 42.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
Subcellular Location Secreted
Protein Families TGF-beta family
Tissue Specificity Expressed in the kidney and bladder. Lower levels seen in the brain.
Database Links

HGNC: 1074

OMIM: 112267

KEGG: hsa:655

STRING: 9606.ENSP00000379204

UniGene: Hs.473163

Pathway Hippo signaling pathway
TGF-beta signaling pathway

Related Products

BMP7 Antibodies

BMP7 Antibodies for Homo sapiens (Human)

BMP7 Antibodies for Human

BMP7 Proteins

BMP7 Proteins for Homo sapiens (Human)

BMP7 ELISA Kit

BMP7 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.