Recombinant Human Bone morphogenetic protein 7 (BMP7)

In Stock
Code CSB-EP002744HUe0
Abbreviation Recombinant Human BMP7 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
BMP 7; BMP-7; Bmp7; BMP7_HUMAN; Bone morphogenetic protein 7; Bone morphogenic protein 7; Eptotermin alfa ; OP 1; OP-1; OP1 ; Osteogenic protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
293-431aa
Target Protein Sequence
STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you confirm the viability of these proteins if they have reached room temperature? How long can they stay at room temperature before denaturing and how can we confirm their viability?

A:
Very nice to receive your inquiry. It is also related to the structure of the proteins. Generally there is no problem to place them at 2-8°C for a week.
There is no conclusion that how long proteins can maintain their stability and activity under room temperature. This is different for different proteins.
For these protein, we have not done stability test yet. We suggest you to perform SDS-PAGE first and then try to perform your experiment.
Pls feel free to contact us if you have further questions.

Target Background

Function
Growth factor of the TGF-beta superfamily that plays important role in various biological processes, including embryogenesis, hematopoiesis, neurogenesis and skeletal morphogenesis. Initiates the canonical BMP signaling cascade by associating with type I receptor ACVR1 and type II receptor ACVR2A. Once all three components are bound together in a complex at the cell surface, ACVR2A phosphorylates and activates ACVR1. In turn, ACVR1 propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. For specific functions such as growth cone collapse in developing spinal neurons and chemotaxis of monocytes, uses also BMPR2 as type II receptor. Can also signal through non-canonical pathways such as P38 MAP kinase signaling cascade that promotes brown adipocyte differentiation through activation of target genes, including members of the SOX family of transcription factors.
Gene References into Functions
  1. Study results indicated that BMP7 serves a key function in regulating the progression of small-cell lung cancer. PMID: 30015928
  2. in this study, the influence of IGF-1 and BMP-7 in different concentrations on the osteogenic differentiation of two human MSC-subtypes, isolated from reaming debris (RMSC) and iliac crest bone marrow (BMSC) has been assessed PMID: 29874864
  3. BMP7 contributes to epithelial-to-mesenchymal transition-like responses and plays a role equivalent to TGF-β in the course of corneal wound healing. PMID: 29747422
  4. On the contrary, BMP7 specific antibody inhibits the HNK-induced activation of p53 in colon cancer cells and partly decreases the total level of p53. Our findings suggested that HNK may be a promising anticancer drug for CRC; activation of p53 plays an important role in the anticancer activity of HNK, which may be initialized partly by the HNK-induced upregulation of BMP7. PMID: 28731124
  5. All isoforms of type I and type II BMP receptors were expressed in both Ca9-22 and HSC3 cells and BMP7 stimulation resulted in the phosphorylation of Smad1/5/8 in both cell lines PMID: 28812969
  6. the results of the present study indicate that BMP7 may inhibit excessive scar formation via activation of the BMP7/Smad1/5/8 signaling pathway. PMID: 28627680
  7. BMP7, in particular combined with MSC, seems to have a favourable application also in periodontal regeneration. PMID: 28735626
  8. Implantation of morphogenetic protein-7 (BMP-7) gene activated fat tissue fragments can elicit regeneration of large bone defects in rats and could become a clinically expeditious strategy for in vivo bone tissue engineering. PMID: 27373764
  9. the present results showed that OP-1 might serve as a biochemical parameter for determining disease severity in primary knee Osteoarthritis (OA). Further studies with larger sample size need to be carried out to confirm OP-1 as a marker of disease status. Studies are required to be done to examine the genetic and lifestyle factors that may contribute to the development of knee OA PMID: 28474632
  10. BMP7-Based Functionalized Self-Assembling Peptides Protect Nucleus Pulposus-Derived Stem Cells From Apoptosis In Vitro PMID: 27582519
  11. results showed that the expression of cartilage-associated markers in ESC-MSCs induced by the TGFbeta1 and BMP7 combination was increased compared to induction with TGFbeta1 alone. The TGFbeta1 and BMP7 combination upregulated the expression of TGFbeta receptor and the production of endogenous TGFbetas compared to TGFbeta1 induction. PMID: 27292615
  12. Overexpression of truncated ALK5 in a B-cell line counteracted BMP-7-induced apoptosis, whereas overexpression of truncated ALK4 had no effect. PMID: 28489883
  13. study suggests that the common genetic polymorphisms of BMP7 gene are not major contributors to variations in Bone Mineral Density or osteoporotic fracture in postmenopausal Chinese women. PMID: 27264311
  14. Patients with hereditary pulmonary arterial hypertension had significantly higher BMP7 concentrations than patients with idiopathic pulmonary arterial hypertension and control subjects. PMID: 27001265
  15. Expression of bone morphogenetic protein 7 ligand was significantly increased in patients with abnormal uterine bleeding. Study demonstrates that bone morphogenetic protein 7 is a promising target for future investigation and pharmacologic treatment of abnormal uterine bleeding. PMID: 28142396
  16. BMP-7 directly upregulates adhesion and migration of human monocytic cells via activation of beta 2 integrins, Akt, and FAK. PMID: 27669124
  17. results showed that stimulation by BMP-7 leads to an increased osteogenic potential of Mesenchymal stem cells. PMID: 28009419
  18. The disequilibrium between BMP-7 and TGF-beta signals plays a relevant role in the LV remodelling response to haemodynamic stress in aortic stenosis patients with left ventricular hypertrophy/dysfunction. PMID: 27068510
  19. BMP7 may partly mediate the antiproliferative effect of oridonin by activating p38 MAPK in colon cancer cells. PMID: 26986967
  20. Data show that interaction of fibrillin-1 with the bone morphogenetic protein 7 (BMP-7) complex results in a conformational change. PMID: 27059954
  21. the role of BMP-7 and its downstream signals in the neuroprotective effects of oxygen-glucose deprivation preconditioning PMID: 26385023
  22. miR-137/BMP7 axis could contribute to the progression of non-small cell lung cancer. PMID: 26617798
  23. Inhibition of BMP7 expression mediated by KDM5C promotes neoplasm invasion in hepatocellular carcinoma cells. PMID: 26503415
  24. Adenovirus-mediated FoxC2 expression enhances BMP7-facilitated anabolism in nucleus pulposus cells of the intervertebral discs. PMID: 26824865
  25. ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7. PMID: 26417691
  26. MiR-22 promotes the development of liver cirrhosis through BMP7 suppression. PMID: 26112332
  27. Transfection of HOXA13 in HKCs could inhibit the degree of EMT induced by albumin-overload, possibly by increasing BMP-7 expression. PMID: 26695677
  28. rs6127973 may be a risk factor of being Nonsyndromic orofacial clefts and confirmed the role of BMP7 gene in orofacial deformity from Western Han Chinese PMID: 25662552
  29. OP-1 levels detected by a polyclonal antibody were found to be much higher than the reference range and correlated positively with the severity of osteoarthritis PMID: 25091889
  30. Exposure of adipogenic stem cells to BMP7 promoted gene expression signatures of brown adipocytes. PMID: 25534037
  31. BMP-7 improves proliferation and hematopoietic reconstitution potential of ex vivo expanded cord blood-derived CD34(+). cells.( PMID: 25192984
  32. hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype PMID: 25716319
  33. Bone morphogenetic protein 7 increased vascular endothelial growth factor-a expression in human granulosa cells and VEGF receptor expression in endothelial cells to stimulate angiogenesis. PMID: 24023033
  34. Study highlights the potential importance of RGMb in propagating pro-angiogenic effects of HGF and BMP-7. PMID: 24970050
  35. BMP-7 may play anti-inflammatory and anti-fibrogenic roles in the pathogenesis of chronic hepatitis B infection. PMID: 24820464
  36. BMP-7 inhibits TGF-beta-induced cholangiocarcinoma cell migration through inhibition of TGF-beta-mediated Twist and N-cadherin expression PMID: 24969562
  37. BMP-7 represses albumin-induced chemokine synthesis in kidney tubular epithelial cells through destabilization of NF-kappaB-inducing kinase. PMID: 24418819
  38. BMP7 expression correlates with secondary drug resistance in mantle cell lymphoma. PMID: 24069261
  39. Expression and purification of recombinant human bone morphogenetic protein-7 in Escherichia coli. PMID: 24117149
  40. These results suggested an association between a BMP7 single nucleotide polymorphism and selective serotonin reuptake inhibitors treatment response. PMID: 23697978
  41. These findings indicate that BMP-7 mediates ischemic preconditioning -induced tolerance to cerebral ischemia/reperfusion, probably through inhibition of apoptosis. PMID: 24184479
  42. BMP7 induces Langerhans cell differentiation and proliferation by activating the BMP type-I receptor ALK3 in the absence of canonical TGF-beta1-ALK5 signaling. PMID: 24190429
  43. summarize recent knowledge of BMP-7 function and discuss attempts to use this cytokine as a drug to reverse TGF-beta-induced fibrogenesis PMID: 23747893
  44. Exogenous BMP-7 significantly decreased the degree of hepatic fibrosis in both the acute and chronic stages of hepato-schistosomiasis, and the regulatory mechanism may involve the TGF-beta/Smad signaling pathway. PMID: 23539268
  45. The anti-fibrogenic mechanism of rhBMP-7 in the rat liver fibrosis was depended on the reduction of TGF-b1 overexpression and the inhibition of TGF-b1 triggered intracellular signalling in hepatic cells. PMID: 23471555
  46. Nucleus pulposus cells expressing hBMP7 can prevent the degeneration of allogenic intervertebral disc degeneration in a canine transplantation model. PMID: 23580474
  47. BMP7 modulates the expression of E-cadherin and MMP-9, and by which mechanism it may regulate cell migration and metastasis of esophageal squamous cell carcinoma. PMID: 23504348
  48. A novel human bone morphogenetic protein-7 variant with an enriched heparin-binding site PMID: 23888776
  49. There is efficient and reproducible induction of SZP/lubricin accumulation by TGF-beta1 and BMP-7 in skeletal muscle-derived mesenchymal stem cells. PMID: 22490392
  50. monoubiquitinated SMAD6 impairs the binding affinity of non-modified SMAD6 to the BMP type I receptor. Moreover, UBE2O and SMAD6 cooperated in the regulation of BMP7-induced adipogenesis PMID: 23455153

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
TGF-beta family
Tissue Specificity
Expressed in the kidney and bladder. Lower levels seen in the brain.
Database Links

HGNC: 1074

OMIM: 112267

KEGG: hsa:655

STRING: 9606.ENSP00000379204

UniGene: Hs.473163

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*