Recombinant Human C-C motif chemokine 18 (CCL18)

Code CSB-EP004781HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004781HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP004781HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP004781HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Alternative macrophage activation associated CC chemokine 1; Alternative macrophage activation-associated CC chemokine 1; AMAC-1; AMAC1; CC chemokine PARC; CCL18; CCL18(4-69); CCL18_HUMAN; CKb7; DC-CK1; DCCK1 ; DCCK1; Dendritic cell chemokine 1; Macrophage inflammatory protein 4; MIP-4; MIP4; PARC; Pulmonary and activation regulated chemokine; Pulmonary and activation-regulated chemokine; SCYA18; Small inducible cytokine A18 ; Small inducible cytokine A18; Small-inducible cytokine A18
Species
Homo sapiens (Human)
Expression Region
21-89aa
Target Protein Sequence
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
Mol. Weight
9.9kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.
Gene References into Functions
  1. miR-128 interacts with CCL18 3'UTR, reducing its expression in malignant melanoma. PMID: 30025750
  2. AMAP1 mediated CCL18-induce activation of NF-kappaB and promoted breast cancer metastasis. PMID: 28834540
  3. results of the study indicate that there could be a relationship between the expression of CCL-18 in nasal turbinate mucosa and the severity of allergic rhinitis PMID: 30102123
  4. chemokine CCL18 can be a mediator of peritoneal membrane failure associated with peritonitis episodes as well as providing a new potential therapeutic target. PMID: 29850544
  5. CCL18 was up-regulated in diffuse large B cell lymphoma and related to poor prognosis PMID: 29504526
  6. Serum C-C motif chemokine ligand 18 (CCL18) was elevated in patients with epithelial ovarian cancer (EOC) and could serve as a new tumor biomarker, which also predicted a poor survival of the patient. PMID: 29036787
  7. In advanced lung adenocarcinoma, infiltration of CCL18(+) tumor-associated macrophages (TAMs) was increased and higher expression of CCL18 by TAMs was associated with a favorable prognosis in lymph-node positive NSCLC PMID: 29970512
  8. This study study discovered a positive feedback loop between CTGF and CCL18 in hepatocellular carcinoma metastasis. PMID: 28837877
  9. All patients with NPC1 mutations had high ChT activity, high CCL18/PARC concentrations and/or Niemann-Pick disease type C suspicion index scores >/=70. PMID: 28222799
  10. findings suggest that these pulmonary markers could be useful to assess CAP severity and, especially YKL-40 and CCL18 by helping predict CAP caused by atypical pathogens PMID: 29324810
  11. PARC activation of neutrophils by sterile immunogenic dying cells drives neutrophil-mediated residual cell killing. PMID: 28234357
  12. Matrigel invasion assays revealed that tumor ECM-educated macrophages efficiently stimulated cancer cell invasion through a mechanism involving CCL18. PMID: 28209528
  13. Our results indicate that CCL18 acts in an autocrine manner via Akt activation to stimulate oral squamous cell carcinoma cell growth and invasion during disease progression PMID: 26919103
  14. Our data indicate that hypoxic inhibition of JMJD3 activity reduces demethylation of H3K27me3, nucleosome removal, and hence induction of the STAT6 target gene CCL18, while induction of other STAT6-inducible genes such as SPINT2 remained unaffected by JMJD3. PMID: 27737800
  15. There was no association between serial CCL18 concentrations with tumor response and overall survival. PMID: 28957436
  16. CCL-18 is a promising biomarker in COPD, as it is associated with frequency of exacerbations, particularly with severe COPD exacerbations requiring hospitalization, as well as with functional parameters and symptom scores. PMID: 28115842
  17. Data suggested that CCL18 upregulated Slug expression to promote epithelial-mesenchymal transition (EMT) and stem cell-like features by activating the mTOR pathway in oral cancer. PMID: 28574664
  18. An increased lung protein expression of PARC in chronic obstructive pulmonary disease patients PMID: 28545096
  19. CCL18 can increase the invasive ability of non-small cell lung cancer cells by binding to its receptor Nir1. PMID: 26756176
  20. Results demonstrate that high levels of CCL18 are present in ovarian cancer (OC) ascites and that CCL18 is an important component of ascites for the ascites-mediated migration of OC cells. Ascites and CCL18 stimulate the phosphorylation and expression of Pyk2, which is critical for mediated CCL18-induced migration. PMID: 27613122
  21. Data suggest that circulating CCL18 and abdominal subcutaneous white adipose tissue-secreted CCL18 correlates with insulin resistance and metabolic syndrome risk score; because CCL18 is macrophage-specific and associates with adipose immune gene expression, it may constitute a marker of adipose tissue inflammation (panniculitis). PMID: 27459538
  22. Cytomegalovirus replication in the allograft causes an intrapulmonary increase of CCL-18 and CCL-20 and a systemic rise of CCL-20 serum levels. Strong intrapulmonary CCL-18 responses are associated with symptomatic HCMV disease, proposing that CCL-18 BALF levels could serve as a marker. PMID: 26910332
  23. Study determined that CCL18 expression was up-regulated in ovarian carcinoma suggesting that CCL18 may play an important role in the pathogenicity of epithelial ovarian cancer through the induction of regulators and the activation of signaling pathways including mTORC2 signaling pathways. PMID: 26457987
  24. CCL18 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  25. release of CCL18 with greater non-small cell lung cancer tumor size is most likely due to the accompanied growth of leukocyte infiltrate PMID: 27630310
  26. this study shows that CCL18 has a correlation with cardiac function in patients with acute anterior myocardial infarction PMID: 27350631
  27. our findings establish a signaling role for CCL18 in gastric cancer cells and identify that the CCL18/ERK1/2/NF-kappaB signaling pathway is essential for tumor invasiveness in gastric cancer cells. PMID: 26242263
  28. CCL18 enhances hepatocellular carcinoma (HCC) cell migration, invasion, and epithelial-mesenchymal transition (EMT) through the expression of PITPNM3 and the activation of the NF-kappaB signaling pathway. PMID: 26449829
  29. our findings suggest that CCL18 released from tumor-associated macrophages promotes angiogenesis and tumor progression in breast cancer. PMID: 26416449
  30. Findings suggest that down-regulation of miR98 and miR27b promotes CCL18-mediated invasion and migration of breast cancer cells. PMID: 26244871
  31. CCL18 is significantly up-regulated in breast cancer vs benign tumors or normal breast. It increased with the size of tumors, the number of lymph node metastasis, and advancing tumor stage. PMID: 26294068
  32. A common CCL18 polymorphism together with intraventricular hemorrhage had an additive influence on cerebral palsy susceptibility. PMID: 26113374
  33. The CCL18 levels in serum and synovial fluid are correlated with the severity of osteoarthritis. PMID: 25794928
  34. Combined functions of CCL18 in mesenchymal and cancer cells might accelerate the progression of PDAC by promoting the epithelial-mesenchymal transition, invasion and migration of pancreatic cancer cells. PMID: 25502147
  35. Increased CCL18 levels characterize chronic Pseudomonas aeruginosa infection and pulmonary obstruction in patients with cystic fibrosis. PMID: 25142483
  36. upregulation of CCL18 may be involved in the malignant progression of prostate cancer. PMID: 25197632
  37. CCL-18 and IGFBP-6 were identified as new potential serum biomarkers for prostate cancer. PMID: 24747338
  38. CCL18 expression was positively correlated with malignancy in EC. PMID: 25275026
  39. Pyk2 and Src are important in CCL18-induced breast cancer metastasis PMID: 24142406
  40. CCL18 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
  41. CCL18 from tumor-associated macrophages induces cancer cell epithelial-mesenchymal transition, forming a positive feedback loop, in coculture systems and humanized mice. PMID: 24823638
  42. Further development of A1AT as a diagnostic biomarker for BCa is warranted. PMID: 24011266
  43. the Cys10-Cys34 disulfide bond is involved in the function of CCL18. PMID: 23742785
  44. genetic polymorphism is associated with lung function in Hutterites, who are a founder population of European descent in North America PMID: 23932459
  45. In patients with systemic sclerosis-related interstitial lung disease, CCL18 was a predictor of short-term decline in forced vital capacity. It was not a longterm prognostic indicator. PMID: 23588945
  46. Data indicate that PYK2 N-terminal domain interacting receptor 1 (Nir1) could induce epithelial-mesenchymal transition by stabilising Snail via the PI3K/Akt/GSK3beta/Snail signalling pathway through binding to CCL18. PMID: 24001613
  47. this review focuses on the potential role, in asthma and lung immunity, of CCL18 a chemokine both constitutively expressed at high levels in the lung and induced in inflammatory conditions PMID: 23786278
  48. Identification of human CCR8 as a CCL18 receptor. PMID: 23999500
  49. A high CCL18 level might be an independent biomarker for predicting better survival of patients with colorectal cancer. PMID: 23433718
  50. CCL18 may be an interesting therapeutic target for NSCLC PMID: 23349697

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood mono
Database Links

HGNC: 10616

OMIM: 603757

KEGG: hsa:6362

STRING: 9606.ENSP00000004921

UniGene: Hs.143961

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1