Recombinant Human C-C motif chemokine 20 (CCL20), partial

In Stock
Code CSB-EP004784HU1c0
Abbreviation Recombinant Human CCL20 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Beta-chemokine exodus-1CC chemokine LAR;CLiver and activation-regulated chemokine;Macrophage inflammatory protein 3 alpha ;MIP-3-alpha;Small-inducible cytokine A20
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-95aa
Target Protein Sequence
ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.4
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions. The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases. CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. C-terminal processed forms have been shown to be equally chemotactically active for leukocytes. Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility. Inhibits proliferation of myeloid progenitors in colony formation assays. May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells. Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213.
Gene References into Functions
  1. CCN1 stimulates CCL20 production in vitro and in vivo, and thus supports the notion that overexpressed CCN1 in hyperproliferating keratinocyte is functionally involved in the recruitment of inflammatory cells to skin lesions affected by psoriasis. PMID: 28602508
  2. Results demonstrated that F. nucleatum ssp. animalis and dysregulated CCL20 protein expression are important factors associated with human colorectal cancer progression. PMID: 28483840
  3. There was underexpression of the majority of genes after sunitinib treatment. The lower expression levels of IGFBP1, CCL20, CXCL6 and FGB were confirmed by qRT-PCR in all cases. The downregulation of gene expression leads us to search for methylation as a mechanism of action of the tyrosine kinase inhibitors PMID: 27834463
  4. CCL20 contributed to invasion and epithelial-mesenchymal transition of RANK over-expressed endometrial cancer cells PMID: 27015366
  5. High expression of CCL20 is associated with cutaneous T-cell lymphoma. PMID: 26789110
  6. These results showed that the higher levels of CXCL10, CCL20 and CCL22 were associated with ischemic heart disease. The serum levels of chemokines may influence by the certain traditional risk factors of IHD and some studied SNPs, but did not influence by treatment and gender of patients. PMID: 27152707
  7. The strongest OR was for CXCL8 (interleukin-8) in serum (96.8, 95% CI: 11.9-790.2). Of these 15 markers, 6 were also significantly elevated in serum from Chile (CCL20, C-reactive protein, CXCL8, CXCL10, resistin, serum amyloid A). PMID: 27173614
  8. CCR6(-) regulatory T cells blunt the restoration of gut Th17 cells along the CCR6-CCL20 axis in treated HIV-1-infected patients. PMID: 26883727
  9. CCL20 provoked a 2.5-fold increase of cell migration and invasion in human cancerous breast epithelial cells ; CCL20 also enhanced MMP- 2 and MMP-9 mRNAs/protein expression and activities. PMID: 28618084
  10. A gut-specific endogenously produced mediator with the capacity to modulate the IL-17/Th17 signaling response. PMID: 28526351
  11. results provide a potential explanation for involvement of the CCL20-CCR6 system in the trafficking of IL-17-producing cells to degenerated IVD tissues PMID: 23823618
  12. MFSD2B, CCL20 and STAT1, or STARD7 and ZNF512 genes may be risk or protect factors in prognosis of ADC; HTR2B, DPP4, and TGFBRAP1 genes may be risk factors in prognosis of SQC. PMID: 27301951
  13. HMC stimulated by IgA1 could produce CCL20 and consequently recruit inflammatory Th17 cells to the kidneys to induce further lesion in IgA nephropathy PMID: 28552941
  14. High CCL20 expression is associated with B-lymphoblastic lymphoma with inflammation. PMID: 27018255
  15. primary cultures of human bronchial epithelial cells and the BEAS-2B cell line were used to examine the effects of bacterial-viral coexposure, as well as each stimulus alone, on epithelial expression of CXCL8 and, in particular, CCL20. PMID: 28283475
  16. Study provides evidence that tumor cells signal to the surrounding healthy cells through CCL20 inducing the modulation of the expression of molecules involved in EMT and promoting angiogenesis directly and indirectly through the secretion of VEGF, a major contributor to angiogenesis. PMID: 26154142
  17. CCL20-recruited immune cells further increase TRAIL resistance of CCL20-producing pancreatic ductal adenocarcinoma cells. PMID: 28188806
  18. Cytomegalovirus replication in the allograft causes an intrapulmonary increase of CCL-18 and CCL-20 and a systemic rise of CCL-20 serum levels. PMID: 26910332
  19. This study evaluated the role of CCL20 and CCR6 in the regulation of laryngeal neoplasms; it showed that these proteins acted on proliferation and metastasis via the p38 pathway and multiple microRNAs. PMID: 27916417
  20. findings provide insight into the important role of macrophage-secreted CCL20 in pancreatic cancer and implicate CCR6/CCL20 as potential therapeutic targets PMID: 27797715
  21. Production of CCL20 from lung cancer cells induces the cell migration and proliferation through PI3K pathway. PMID: 26968871
  22. There were early increased plasma concentrations of CCL20 and CCR6 in patients with sepsis. CCL20 and CCR6 correlate with severity of illness in ICU patients. PMID: 26771764
  23. ADAM10 activity contributes to house dust mite-induced shedding of chemokines, including CCL20 PMID: 26296735
  24. Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients. PMID: 26634210
  25. High-risk HPV-type lesions might inhibit the chemokine CCL20 on Langerhans cells through E6 and E7 to escape the immune response. PMID: 26400278
  26. High CCL20 expression is associated with Inflammatory Bowel Disease. PMID: 26536229
  27. Tregs of unexplained recurrent miscarriage patients was significantly lower than that in controls. CCL20-CCR6 could drive immune activity of CD4(+)FOXP3(+) Tregs, followed by their migration to the feto-maternal microenvironment PMID: 26345847
  28. human lung epithelial cells secrete CCL20 and BD2 in response to B. abortus and/or to cytokines produced by infected monocytes. PMID: 26448160
  29. AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer. PMID: 26156805
  30. CCL20 enhanced osteoblast-mediated osteoclastogenesis, partly via IL-6 production, suggesting that CCL20 may contribute to osteoporosis in rheumatoid arthritis by affecting bone cell communication. PMID: 26103626
  31. Th17 cells are recruited into tumor tissues preferentially through CCR6-CCL20 pathway PMID: 25768730
  32. High CCL20 expression is associated with colon cancer. PMID: 24866282
  33. stimulates leukocyte migration in ovary, may aid in final ovulatory events PMID: 26125463
  34. CCL20 cooperated with CCR6 could recruit T regulatory cells to tumor sites, and chemotherapy medicine docetaxel could decrease the expression of CCL20. PMID: 25661365
  35. CCL20 expression is associated with HCC recurrence and patient survival and promotes HCC cell proliferation and migration by inducing EMT-like changes via PI3K/AKT and Wnt/beta-catenin pathways. PMID: 25593462
  36. A TGF-beta-responsive enhancer element required for efficient IL-1beta-dependent expression of the proinflammatory chemokine CCL20 by human lung fibroblasts. PMID: 25918170
  37. Results indicate that CCL20 is crucial for tobacco smoke-caused lung cancer, and anti-CCL20 could be a rational approach to fight against this deadly disease. PMID: 25864589
  38. Overexpression of CCL20 in human proximal tubular cells is inhibited by blockade of KCa3.1 under diabetic conditions through inhibition of the NF-kappaB pathway. PMID: 24733189
  39. glucocorticoids enhance CCL20 production by bronchial epithelium, which may constitute a novel mechanism in Th17-mediated glucocorticoid-insensitive inflammation in asthma PMID: 24627531
  40. We conclude that CCL 20 mRNA expression in the conjunctival epithelium plays a crucial role in regulating homeostasis at the ocular surface and in exacerbation of vernal keratoconjunctivitis . PMID: 25172034
  41. CCL20 rs6749704 polymorphism was associated with secondary progressive multiple sclerosis. PMID: 24395091
  42. identify Syk as an upstream signaling molecule in IL-17A-induced Act1-TRAF6 interaction in keratinocytes, and inhibition of Syk can attenuate CCL20 production PMID: 25202827
  43. CCL20 could be an immune marker in ANCA-associated vasculitis. PMID: 25352172
  44. a differential regulation pattern for genes solely expressed in Th17 cells (IL17A and CCL20) compared to genes expressed in both Th17 and Th1 cells (IL23R and IL12RB2), where high levels of promoter methylation are correlated to near zero PMID: 22715389
  45. CCL20 levels were significantly elevated in the CSF of patients with pneumococcal meningitis. PMID: 24699535
  46. CCL20 and 14-3-3 zeta are molecules that play a putative role during tumorgenesis in pancreas, and may therefore be new parameters for histological diagnosis and discrimination between pancreatic neoplasms and chronic pancreatitis. PMID: 24629487
  47. CCR6/CCL20 biological axis increased the capacity of proliferation and adhesion, as well as the chemotactic migration and the level of cytokines related to degraded extracellular matrix. PMID: 24743888
  48. Data indicate that periodontal ligament stem cells (hPDLSCs) express a functional P2X7 ATP receptor, whose activation is linked to the production of pro-inflammatory molecules IL8 and CCL20. PMID: 24851271
  49. genetic and biological role of the C-C chemokine ligand CCL20 and the C-C chemokine receptor CCR6in rheumatoid arthritis, is discussed.[review] PMID: 24394994
  50. IL-6 produced from IL-1beta-stimulated human periodontal ligament cells could increase CCL20 production. PMID: 24081898

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate, testis, small intes
Database Links

HGNC: 10619

OMIM: 601960

KEGG: hsa:6364

STRING: 9606.ENSP00000351671

UniGene: Hs.75498

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*