Recombinant Human C-C motif chemokine 25 (CCL25)

Code CSB-EP004789HU
Abbreviation Recombinant Human CCL25 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
A130072A22Rik; C-C motif chemokine 25; CCL 25; CCL25; CCL25_HUMAN; Chemokine (C C motif) ligand 25; Chemokine (CC motif) ligand 25; Chemokine C C motif ligand 25; Chemokine CC motif ligand 25; Chemokine TECK; Ck beta 15; Ckb 15; Ckb15; MGC125074; MGC150327; SCY A25; SCYA 25; SCYA25; Small inducible cytokine A25; Small inducible cytokine A25 isoform 1 precursor; Small inducible cytokine A25 isoform 2 precursor; Small inducible cytokine subfamily A (Cys Cys) member 25; Small inducible cytokine subfamily A Cys Cys member 25; Small inducible cytokine subfamily A; member 25; Small-inducible cytokine A25; TECK; TECKvar; Thymus expressed chemokine; Thymus-expressed chemokine
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-150aa
Target Protein Sequence
QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.
Gene References into Functions
  1. CCL25 was able to induce proteoglycan and collagen type I production in anulus fibrosus-derived cells. PMID: 30060561
  2. It plays a pathogenic role in liver diseases and it will be a therapeutic target of the diseases. PMID: 27795503
  3. TECK was shown to be expressed by osteoblasts, and its receptor, CCR9, by osteoclast precursors. TECK increased P. gingivalis LPS-induced osteoclast numbers in an in vitro osteoclast formation assay using osteoclast precursors. T PMID: 26921718
  4. that CCL25/CCR9 signal may provide cancer cells with chemotactic abilities through influencing several epithelial-mesenchymal transitionmarkers PMID: 27008282
  5. CCR9/CCL25 interactions are not only involved in colitis pathogenesis but also correlate with colonic inflammatory burden; further supporting the existence of overlapping mucosal lymphocyte recruitment pathways between the inflamed colon and liver. PMID: 26873648
  6. CpG methylation is reduced in gingival biopsies of patients with periodontitis PMID: 26472015
  7. Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis. PMID: 26879872
  8. CCL25 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group. PMID: 26279399
  9. CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway. PMID: 25691296
  10. High CCL25 expression is associated with the pathogenesis of ulcerative colitis. PMID: 24936795
  11. Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls. PMID: 25296976
  12. TECK derived from endometrial stromal cell and macrophages upregulates the number and function of Tregs in the ectopic milieu. PMID: 25275597
  13. CCL25 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus. PMID: 12949249
  14. CCL25 and CCR9 regulate colorectal cancer progression and invasion. PMID: 22863617
  15. cell migration assays revealed that mesenchymal stromal cells (MSCs) have tropism toward multiple myeloma (MM) cells, and CCL25 was identified as a major MM cell-produced chemoattractant for MSCs. PMID: 22102554
  16. We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. PMID: 21637913
  17. CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion. PMID: 21344163
  18. CCL25 may be involved in the differentiation of monocytes to macrophages particularly in rheumatoid arthritis PMID: 20738854
  19. over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis. PMID: 20081876
  20. demonstrate a unique pattern of regulation for CCL25 and suggest a role for caudal type homeo box proteins in regulating CCL25 transcription PMID: 16517733
  21. Intracellular signaling required for CCL25-stimulated T cell adhesion mediated by the integrin alpha4beta1. PMID: 17510295
  22. High expression may explain high incidence of melanoma metastis to the small intestine. PMID: 18245522
  23. There was a robust migration of specific IgA- and IgM-antibody-secreting cells induced by Salmonella vaccination toward the mucosal chemokines CCL25 and CCL28 PMID: 19003934

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Database Links

HGNC: 10624

OMIM: 602565

KEGG: hsa:6370

STRING: 9606.ENSP00000375086

UniGene: Hs.310511

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*