Your Good Partner in Biology Research
Your Good Partner in Biology Research
| Code | CSB-EP004802HU |
| Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | CCL8 |
| Uniprot No. | P80075 |
| Research Area | Immunology |
| Alternative Names | Ccl8; CCL8_HUMAN; HC14; MCP-2; MCP-2(6-76); Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; SCYA10; SCYA8; Small-inducible cytokine A8 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 24-99aa |
| Target Protein Sequence | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 35.9kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal GST-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Do you happen to have LAL testing done on your CCL8 protein, expressed in Yeast, catalog number CSB-EP004802HU ? We are interested in using this on cells, but we are worried about endotoxin levels. If not, is that something that your company is easily able to run and find out?
| Function (From Uniprot) |
Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
|
| Gene References into Functions |
|
| Subcellular Location | Secreted. |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate. |
| Database Links |
HGNC: 10635 OMIM: 602283 KEGG: hsa:6355 STRING: 9606.ENSP00000378118 UniGene: Hs.271387 |
