Recombinant Human CCAAT/enhancer-binding protein beta (CEBPB)

In Stock
Code CSB-EP005181HU
Abbreviation Recombinant Human CEBPB protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Liver activator protein;Liver-enriched inhibitory protein;Nuclear factor NF-IL6;Transcription factor 5
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-345aa
Target Protein Sequence
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Plays also a significant role in adipogenesis, as well as in the gluconeogenic pathway, liver regeneration, and hematopoiesis. The consensus recognition site is 5'-TEssential for gene expression induction in activated macrophages. Plays a major role in immune responses such as CD4(+) T-cell response, granuloma formation and endotoxin shock. Not essential for intracellular bacteria killing.; Acts as a dominant negative through heterodimerization with isoform 2. Promotes osteoblast differentiation and osteoclastogenesis.
Gene References into Functions
  1. CEBPbeta enhances platinum resistance of ovarian cancer cells by reprogramming H3K79 methylation. PMID: 29712898
  2. Our data suggest that activation of the GPR91-ERK1/2-C/EBP beta (c-Fos, HIF-1a) signaling pathway plays a tonic role in regulating VEGF transcription in rat retinal ganglion cells. PMID: 28374767
  3. C/EBPbeta contributes to all-trans retinoic acid-induced activation of NEAT1 during acute promyelocytic leukemia cell differentiation. PMID: 29111326
  4. Palmitate can induce lipid accumulation in HepG2 cells by activating C/EBPbeta-mediated G0S2 expression. PMID: 29209111
  5. Anti-tumor effect of Rg3, which is mediated by inhibition of C/EBPbeta/NF-kappaB signaling. PMID: 29169725
  6. C/EBPbeta upregulation promoted tumor cell invasion in an MMP3-dependent manner in vitro and was associated with metastatic status in colorectal cancer PMID: 29172775
  7. findings support the hypothesis that maternal diabetes-induced ER stress increases CHOP expression which represses PGC-1alpha through suppressing the C/EBPbeta transcriptional activity, subsequently induces mitochondrial dysfunction and ultimately results in NTDs PMID: 28482072
  8. Studies indicate that CCAAT enhancer binding protein beta (C/EBPB)-transcription factor CITED4 (CITED4) signaling is a pathway in cardioprotection mediating benefits of exercise in heart. PMID: 29098625
  9. C/EBP beta LAP isoform expression was increased and LIP/TNFAIP3/TNIP1 expression was decreased in systemic lupus erythematosus (SLE) patients. LAP expression was positively correlated with SLE disease activity; TNFAIP3 and TNIP1 expression was negatively correlated with SLE disease activity. PMID: 27659348
  10. Overexpression of C/EBPbeta-1 increases transformation, upregulates expression of the cancer stem cell marker ALDH1A1, and leads to chemoresistance. PMID: 28148901
  11. Elevated expression of CEBPB were associated with a decreased risk of hepatocellular carcinoma. PMID: 28321907
  12. C/EBPbeta overexpression or knockdown did not change the levels of IL-1beta-induced SOCS1. SOCS1 regulated the levels of C/EBPbeta mRNA by ubiquitination of C/EBPbeta as well as transcriptional regulation in human chondrocytes. PMID: 27339399
  13. C/EBPbeta suppresses miR-17-92 via two pathways - indirectly through induction of PU.1 expression, where it functions as an activator, and more efficiently, through direct interaction with the miR-17-92 promoter. PMID: 26868909
  14. p300-dependent histone H3 acetylation and C/EBPbeta-regulated IKKbeta expression contribute to thrombin-induced IL-8/CXCL8 expression in human lung epithelial cells. PMID: 28428115
  15. C/EBPbeta negatively regulates PR-B expression in glioblastoma cells. PMID: 27663075
  16. High CEBPB expression is associated with recurrence in Glioma. PMID: 28754668
  17. Study results show the role of WT1 in regulating decidualization in human endometrial stromal cells. C/EBPbeta is an upstream gene that regulates WT1 expression by binding to the novel enhancer region. PMID: 28977591
  18. EGFR and C/EBP-beta oncogenic signaling is bidirectional in human glioma and varies with the C/EBP-beta isoform PMID: 27572958
  19. expressed in intervertebral discs PMID: 26505752
  20. Data show that in an in vitro acute lung injury model established by lipopolysaccharide induction, phosphorylation of C/EBP beta was decreased and bioinformatics analysis discovered a putative binding site of C/EBP beta in CCSP1 promoter; LPS stimulation reduced C/EBP beta phosphorylation and suppressed the transcription of CCSP1. PMID: 28760550
  21. Increased polyamine metabolism in CRC could be driven by c-Myc and C/EBPbeta rather than Bacteroides fragilis infection. PMID: 27433286
  22. A transcription factor complex consisting of ATF6 (an endoplasmic reticulum-resident factor) and C/EBP-beta is required for the IFN-gamma-induced expression of DAPK1 IFN-gamma-induced proteolytic processing of ATF6 and phosphorylation of C/EBP-beta are obligatory for the formation of this transcriptional complex PMID: 27590344
  23. Data show that CCAAT/enhancer-binding protein beta (C/EBP beta) expression is increased in endothelial cells and retinal pigment epithelial cells infected by Toxoplasma gondii, resulting in the activation of autophagy in host cells by inhibiting mechanistic target of rapamycin protein (mTOR) pathway. PMID: 28092463
  24. Data suggest that melatonin down-regulates adipogenesis via reduction of (a) cAMP synthesis, (b) reactive oxygen species synthesis, (c) phosphorylation of CEBPB (CCAAT-enhancer-binding protein-beta), and (d) activation of GSK3B (glycogen synthase kinase 3 beta); primary mesenchymal stem cells cultured in adipogenic differentiation media were used in these studies. PMID: 26797706
  25. we concluded that staurosporine enhanced ATRAinduced granulocytic differentiation in U937 cells via MEK/ERK-mediated modulation of the protein level of C/EBPs PMID: 27665842
  26. C/EBPbeta-Thr217 phosphorylation is essential for the activation of the inflammasome in liver macrophages and for the hepatocyte apoptosis induced by hepatotoxins that results in liver injury. PMID: 27067260
  27. The study aimed to identify a small set of genetic signatures that may reliably predict the individuals with a high genetic propensity to heroin addiction. A set of 4 genes (JUN, CEBPB, PRKCB, ENO2, or CEBPG) could predict the diagnosis of heroin addiction with the accuracy rate around 85% in our dataset. PMID: 27495086
  28. The increase of nuclear C/EBPbeta protein was dependent on p38. PMID: 27833915
  29. ER stress appears to play a regulatory role in the inflammatory response and extracellular matrix degradation in human periodontal ligament cells in response to LPS stimuli by activating C/EBP beta expression. PMID: 27011164
  30. our data demonstrate that C/EBPbeta plays a central role in controlling Gadd45beta gene expression in articular chondrocytes PMID: 26896926
  31. CREB is a transcriptional regulator of C/EBPbeta in gastric cancer cells. PMID: 25740226
  32. C/EBPbeta and NFkappaB inhibition by melatonin may impede both gastric tumor growth and peritoneal dissemination by inducing ER stress and inhibiting EMT. PMID: 26514342
  33. C/EBPbeta promotes autophagy in PC3 cells by augmenting REDD1 expression. PMID: 26968249
  34. TNF-a induced MMP1/3 expression, which was abrogated by C/EBPb knockdown or p38 MAPK inhibition. PMID: 25959126
  35. Loss of C/EBPbeta expression in primary myoblasts rescues differentiation under cachectic conditions without restoring myotube size, indicating that C/EBPbeta is an important inhibitor of myogenesis in cancer cachexia. PMID: 26709824
  36. Letter: elevated C/EBPbeta in advanced COPD may be an indication of a breakdown of regulatory mechanisms and excessive inflammation. PMID: 26511475
  37. the oxidative stress-induced overexpression of C/EBPbeta might influence the activity of MMPs by regulating the Wnt/beta-catenin signaling pathway to affect the invasion of trophoblast cells, and participate in the pathogenesis of preeclampsia. PMID: 26166436
  38. This study established a correlation between miR-155 and TLR7 during hepatitis B virus infection and also demonstrated in vitro that increased miR-155 level could help to reduce viral load by targeting C/EBP-beta. PMID: 25720442
  39. Low CEBPB expression is associated with metastasis in hepatocellular carcinoma. PMID: 25965830
  40. Global profiling in human mesenchymal stem cells and a novel cell-free assay reveals that ATF4 requires C/EBPbeta for genomic binding at a motif distinct from that bound by the C/EBPbeta homodimer. PMID: 26111340
  41. High CEBPB expression is associated with prostate cancer. PMID: 25772238
  42. C/EBPbeta could promote the invasion and migration of human renal carcinoma 786-O cells, and had an inducing effect on nuclear translocation of NF-kappaB in 786-O cells. PMID: 26522356
  43. C/EBPbeta induces growth arrest in a colorectal cancer cell line and that its expression is negatively correlated with the miR-191 level in patient samples. PMID: 25784653
  44. CCAAT/enhancer binding protein beta is dispensable for development of lung adenocarcinoma. PMID: 25767874
  45. C/EBPbeta was the main regulator of P2X7 receptor expression in response to a glucose challenge. C/EBPalpha and the C/EBPbeta-LIP isoform blocked the C/EBPbeta-dependent regulation of P2X7 receptor transcription. PMID: 25403356
  46. these studies show that C/EBPbeta increases S100A4 levels by directly activating S100A4 promoter expression in glioblastoma cells and provide evidence that S100A4 may contribute to the C/EBPbeta-induced invasiveness. PMID: 25738360
  47. EGF up-regulates miR-31 through the C/EBPbeta signal cascade in oral carcinoma PMID: 25229239
  48. The results found that C/EBP-beta is an important transcription factor within the metabolic disturbances of the metabolic system. PMID: 25699273
  49. C/EBPbeta, especially C/EBPbeta-LIP in cooperation with ATF4, is involved in osteoclast formation by regulating RANKL expression in RA-FLS. These findings suggest that C/EBPbeta plays a crucial role in bone destruction in RA joints PMID: 25811130
  50. The C/EBPbeta transcription factor plays a role in hematological malignancies of both myeloid and lymphoid lineage origin. [Review] PMID: 25940801

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
BZIP family, C/EBP subfamily
Tissue Specificity
Expressed at low levels in the lung, kidney and spleen.
Database Links

HGNC: 1834

OMIM: 189965

KEGG: hsa:1051

STRING: 9606.ENSP00000305422

UniGene: Hs.517106

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*