Recombinant Human CD59 glycoprotein(CD59)

In Stock
Code CSB-YP004947HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P13987
Lead Time 3-7 business days
Relevance Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 1F5 antigen20 kDa homologous restriction factor ;HRF-20 ;HRF20MAC-inhibitory protein ;MAC-IPMEM43 antigen;Membrane attack complex inhibition factor ;MACIFMembrane inhibitor of reactive lysis ;MIRLProtectin; CD59
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Research Area Cardiovascular
Source Yeast
Gene Names CD59
Protein Names Recommended name: CD59 glycoprotein Alternative name(s): 1F5 antigen 20 kDa homologous restriction factor Short name= HRF-20 Short name= HRF20 MAC-inhibitory protein Short name= MAC-IP MEM43 antigen Membrane at
Expression Region 26-102aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; FUNCTION
Involvement in disease Hemolytic anemia, CD59-mediated, with or without polyneuropathy (HACD59)
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Database Links

HGNC: 1689

OMIM: 107271

KEGG: hsa:966

STRING: 9606.ENSP00000340210

UniGene: Hs.278573

Pathway Complement and coagulation cascades
Hematopoietic cell lineage

Related Products

CD59 Antibodies

CD59 Antibodies for Homo sapiens (Human)

CD59 Antibodies for Human

CD59 Proteins

CD59 Proteins for Homo sapiens (Human)

CD59 ELISA Kit

CD59 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.