Recombinant Human CD59 glycoprotein(CD59)

In Stock
Code CSB-YP004947HU
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CD59
Uniprot No. P13987
Research Area Cardiovascular
Alternative Names 16.3A5; 1F5 ; 1F5 antigen; 20 kDa homologous restriction factor; CD 59; CD_antigen=CD59; CD59; CD59 antigen; CD59 antigen complement regulatory protein ; CD59 antigen p18 20 ; CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5; EJ16; EJ30; EL32 and G344); CD59 glycoprotein; CD59 molecule; CD59 molecule complement regulatory protein; CD59_HUMAN; Cd59a; Complement regulatory protein; EJ16; EJ30; EL32; FLJ38134; FLJ92039; G344; HRF 20; HRF-20; HRF20; Human leukocyte antigen MIC11 ; Ly 6 like protein ; Lymphocytic antigen CD59/MEM43 ; MAC inhibitory protein; MAC IP; MAC-inhibitory protein; MAC-IP; MACIF; MACIP; MEM43; MEM43 antigen; Membrane attack complex (MAC) inhibition factor ; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MGC2354; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18 20; Protectin; Surface antigen recognized by monoclonal 16.3A5; T cell activating protein
Species Homo sapiens (Human)
Source Yeast
Expression Region 26-102aa
Target Protein Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 11.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; FUNCTION
Gene References into Functions
  1. Parainfluenza Virus 5 (PIV5) containing CD59 antigens (PIV5-CD59) shows increased resistance to complement-mediated neutralization in vitro comparing to PIV5 lacking regulators. Infection of A549 cells with PIV5 upregulates CD59 expression. TGF-beta treatment of PIV5-infected cells also increases cell surface CD59 expression and progeny virions are more resistant to complement-mediated neutralization. PMID: 29693588
  2. Nonfunctioning CD59 is a major risk factor for stroke and hypercoagulability. PMID: 29929138
  3. Therapeutic strategies that seek to modulate the functions of CD59 in the tumor microenvironment could be a promising direction for tumor immunotherapy. PMID: 29521526
  4. This study demonstrated that Diffuse microvascular C5b-9 deposition is a common feature in muscle and nerve biopsies from diabetic patients. PMID: 29458425
  5. Movement of Domain 2 with respect to Domain 3 of ILY is essential for forming a late prepore intermediate that releases CD59, while the role of cholesterol may be limited to insertion of the transmembrane segments. Together these data define a structural timeline for ILY pore formation and suggest a mechanism that is relevant to understanding other pore-forming toxins that also require CD59. PMID: 27910935
  6. CD59 polymorphisms are associated with gene expression and different sexual susceptibility to pemphigus foliaceus in the Brazilian patients. PMID: 28534443
  7. we demonstrated that CD59 regulation by SOX2 is required for stem cell evasion of complement surveillance. This finding highlights the importance of complement surveillance in eliminating CSCs and may suggest CD59 as a potential target for cancer therapy. PMID: 28017655
  8. The results indicate that shear stress is an important mediator in endothelial progenitor cells expression of CD59 regulated by the extacellular matrix-integrin alphaVbeta3-F-actin pathway, which is a key factor in preventing membrane attack complex-mediated cell autolysis. PMID: 28943429
  9. Data show that following 4 patients with CD59 Cys89Tyr mutations who are treated with eculizumab, no strokes occurred and non-permanent neurological insults underwent resolution without any new neurological exacerbations. PMID: 28622911
  10. our results indicate that the Lys(41) /His(44) glycation motif in human CD59 may confer humans a higher risk of developing vascular disease in response to hyperglycemia. PMID: 28815695
  11. Structural basis for receptor recognition by the human CD59-responsive cholesterol-dependent cytolysins has been presented. PMID: 27499440
  12. developed a model of conditional and targeted cell ablation by generating floxed STOP-CD59 knockin mice (ihCD59), in which expression of human CD59 only occurs after Cre-mediated recombination PMID: 27159394
  13. Our results revealed that SNPs CD59-rs831626 and CFH-rs1065489 were associated with the susceptibility of acute anterior uveitis. PMID: 27419833
  14. Novel disorder caused by CD59 deficiency or nonfunctional CD59 at the cell membrane presenting with symptoms characteristic of classical GBS or CIDP. PMID: 27568864
  15. Single-fluorescent-molecule imaging in the live-cell plasma membrane revealed the clear but transient colocalization and codiffusion of fluorescent ganglioside analogs with a fluorescently labeled glycosylphosphatidylinisotol (GPI)-anchored protein, human CD59, with lifetimes of 12 ms for CD59 monomers, 40 ms for CD59's transient homodimer rafts in quiescent cells. PMID: 27043189
  16. There is an altered pattern of CD55 and CD59 expression on RBCs of SCD Patients; however, it does not seem to play a causal role in the pathophysiology of anemia, and is unlikely to be influenced by the level of erythropoietin or other inflammatory mediators. PMID: 27667587
  17. Study revealed that CD59 is overexpressed in breast cancer tumors and correlates with poor survival. PMID: 26935178
  18. A Promoter Polymorphism in the CD59 Gene in Donor Lungs Correlates With a Higher Risk for Chronic Rejection After Lung Transplantation. PMID: 26517734
  19. Urinary CD59 and alpha-1 antitrypsin are significantly altered in hypertensive patients developing albuminuria. PMID: 26772976
  20. levels of CSF CD59 in neuromyelitis optica and multiple sclerosis PMID: 26686775
  21. Increased internalization of endothelial CD59 in intermittent hypoxia appeared to be cholesterol-dependent and was reversed by statins in a CD59-dependent manner. PMID: 26738794
  22. Low urine CD59 expression is associated with clear cell renal cell carcinoma. PMID: 26420021
  23. Decreased CD59 expression in threatened miscarriage at late gestational ages leads to additional activation of a maternal immune response and serves as a possible predictor for premature birth. PMID: 26978230
  24. Data show that the palmitoylation mutation of linker for activation of T cells (LAT)attenuated the signal transduction induced by glycosylphosphatidylinositol-anchored CD59 antigen in T cells. PMID: 26271970
  25. After blockage of CD59 function, the reactive Abs, regardless of their neutralizing activities, significantly enhanced specific ADCML of HIV-1 virions PMID: 26136568
  26. Genetic risk at the CFH-to-F13B locus was associated with higher levels of complement activation at the human macular RPE-choroid interface, as was cigarette smoking. Levels of CRP were substantially elevated in risk donors with smoking history. PMID: 26218915
  27. A primary homozygous Cys89Tyr CD59 deficiency in humans resulted in the amino acid substitution p.Cys89Tyr with ensuing failure of proper localization of the CD59 protein to the cell surface. (Review) PMID: 25818314
  28. Increased CD59 protein expression is associated with the outcome of patients with diffuse large B-cell lymphoma treated with R-CHOP antineoplastic protocol. PMID: 24924474
  29. Data suggest that microRNA-224 directly down-regulates CD59 antigen expression in diffuse large B-cell lymphoma by binding to CD59 3'-untranslated region. PMID: 25146331
  30. Expression of membrane complement regulators, CD46, CD55 and CD59, in mesothelial cells of patients on peritoneal dialysis therapy. PMID: 25725314
  31. The presence of CD55- and/or CD59-deficient erythrocytic populations in patients with rheumatic diseases reflects an immune-mediated bone-marrow derived phenomenon. PMID: 24463881
  32. Provirus activation plus CD59 blockage triggers antibody-dependent complement-mediated lysis of latently HIV-1-infected cells. PMID: 25149467
  33. Data indicate that down-regulation of CD59 expression could inhibit HeLa cells' proliferation and promote apoptosis, and the inhibitory effect of peptide seal was better than that of CD59 interference plasmid. PMID: 24909278
  34. The expression levels of CD46, CD55, and CD59 were significantly higher in colon cancer tissues compared with the normal adjacent colon tissues. PMID: 24978917
  35. this study observed robust relationships between a single measurement of blood levels of GCD59 and both acute (2-hour OGTT) and chronic (HbA1c) measures of glucose handling. PMID: 24628556
  36. Hemolytic uremic syndrome evolved independently from CD55 and CD59 expression on peripheral blood cells in enteroaggregative E.coli O104:H4 infected patients. PMID: 24086391
  37. Data suggest that CD59 gene might be a genetic locus for the therapy of atherosclerosis. PMID: 24084445
  38. We found that CD46 and CD59 were decreased in retinal pigment epithelium cells in part, by their release in exosomes and apoptotic particles. PMID: 24664706
  39. Use of AAV2/8-sCD59 warrants further exploration as a potential therapy for advanced stages of diabetic retinopathy PMID: 24167638
  40. Sp1 may regulate the expression of CD59, whereas CREB-binding protein (CBP)/p300 bridge NF-kappaB and CREB, which functions as an enhancer-binding protein to induce the up-regulation of CD59 during in lipopolysaccharide (LPS)-triggered complement activation. PMID: 24338025
  41. CD59 silencing in NSCLC cancer cells via retrovirus-mediated RNAi can enhance complement-mediated cell apoptosis, inhibiting the growth of NSCLC. CD59 may serve as a potential target for gene therapy in NSCLC PMID: 23835643
  42. mutation of palmitoylation site of LAT-EGFP attenuated the signal transduction of CD59 in T cells PMID: 24200054
  43. The primary CD59-ILY binding site is composed of a side-to-side contact between the beta hairpin extension of ILY D4 and the core beta sheet of CD59. PMID: 23665225
  44. Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection. PMID: 23376460
  45. Hematology and diabetes: from hemoglobin A1c to CD59 glycation. PMID: 23757192
  46. a novel, sensitive, and specific ELISA for measuring GCD59 in blood. The assay distinguished individuals with diabetes from those without, and showed strong correlation between GCD59 and HbA1c. PMID: 23670858
  47. CD59 was a type of membrane-bound protein, CD59 and Cbp played synergistic roles in cell activation and proliferation. PMID: 23746236
  48. HCV incorporates selectively CD59, but not CD46 or CD55, in its envelope to gain resistance to CML in serum of infected individuals PMID: 23049856
  49. A Cys89Tyr mutation is associated with improper cell-surface localization of CD59. This mutation is manifested clinically in infancy by chronic hemolysis & relapsing peripheral demyelinating disease. PMID: 23149847
  50. findings demonstrated that decreased CD59 expression on T cells significantly enhanced activation and proliferation of CD4( ) T cells and CD8( ) T cells; data support that CD59 down-regulates antigen-specific activation of T lymphocytes in a ligand-dependent manner PMID: 22480874
  51. CD59 was expressed both on freshly prepared and frozen-stored samples. Higher level of CD59 was detected on ICAM1+ mesenchymal cells than on nanog+ epithelial cells. PMID: 22701098
  52. Data suggest that HBXIP upregulates CD46, CD55 and CD59 through p-ERK1/2/NF-kappaB signaling to protect breast cancer from complement-dependent cytotoxicity. PMID: 22293503
  53. CD59 is incorporated into both cell line-derived and plasma primary hepatitis C virus virions at levels that protect against antibody-dependent complement-mediated lysis. PMID: 21932413
  54. Overexpression of CD59 promoted the proliferation of MCF-7 breast cancer cells and inhibited anti-apoptotic Bcl-2 expression making CD59 a promising target in the gene therapy of breast cancer. PMID: 22000275
  55. The lipopolysaccharide of Treponema denticola and Tannerella forsythia were the most potent for increasing the gene expression of CD55 and CD59, and to a lesser extent CD46, after a 48-h stimulation. PMID: 21545652
  56. Studies indicate that decreased expression of CD55+ and CD59+ on lymphocyte were found in 11 SLE patients accompanied by lymphocytopenia compared with controls. PMID: 21802665
  57. Data show no correlation between degree of expression of RBC surface receptors CR1, CD55 and CD59 with haemoglobin level, but CD55 expression was less in malaria cases than in healthy controls. PMID: 21727667
  58. The viability of a non membrane-targeted soluble CD59 to significantly inhibit complement deposition on the endothelium of murine liver vasculature, was demonstrated. PMID: 21720565
  59. The expression of CD59 became normal after acute promyelocytic leukemia patients achieved complete remission, which indicated that the deficient of CD59 expression was only found in APL blast cells. PMID: 21129240
  60. Data suggest that preemptive elimination of CD59-overexpressing subpopulations along with rituximab treatment may be a useful approach to ablate or conquer rituximab resistance. PMID: 21252115
  61. A mutation in the W40 site of CD59 reduced inhibition of complement and increased proliferation of ovarian cancer A2780 cells. PMID: 19622297
  62. EHD1 is involved in the control of CD59 transport from pre-sorting endosomes to the ERC in a PKC-dependent manner PMID: 20961375
  63. In non-Hodgkin lymphoma patients treated with rituximab plus chemotherapy, expression of CD59 was higher in patients with complete remission and in those with bulky disease than in non-responders. CD59 expression may be related to resistance to rituximab. PMID: 19662541
  64. there is an altered pattern of CD59 expression on the peripheral blood cells of systemic lupus erythematosus patients;may play a role in the cytopenias PMID: 20727519
  65. High CD59 is associated with aplastic anemia. PMID: 20689133
  66. The complement regulatory factors CD55 and CD59 were also reduced to a significant extent as a consequence of Adenovirus 11p binding to K562 cells. PMID: 20638094
  67. Transgenic overexpression of human CD59 (hCD59(ICAM-2+/-)/ApoE(-/-)) in this mice model attenuated the progression of abdominal aortic aneurysm. PMID: 20212283
  68. The release rate of glycated mutanted CD59 was higher than that of unglycated ones in diabetic Vascular Complications. PMID: 19737458
  69. CD55 and CD59 expressions on peripheral blood leucocytes are decreased in T2DM patients with macrovascular diseases. PMID: 19781296
  70. Antigen-presenting cell exosomes are protected from complement-mediated lysis by expression of CD55 and CD59. PMID: 12645951
  71. Although CD55 and CD59 deficiency in primary or secondary AIHA, it appears that this defect plays a facilitator rather than a triggering role for the hemolytic process. PMID: 12880676
  72. CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity. PMID: 14635045
  73. Complement regulatory proteins such as MCP and CD59 are expressed in the human and wild-type embryonic brain. PMID: 14962294
  74. Presence of CD59 on Purkinje cells at various levels in eight of 14 cases with no cerebellar pathology suggests that Purkinje cells not expressing CD59 could be especially prone to complement-mediated damage. PMID: 15147772
  75. Significant difference in intensity of the staining of CD55 and CD46 among cells in various layers of normal esophageal mucosa and esophageal carcinoma cells, but not in the staining of CD59. PMID: 15151618
  76. During respiratory syncytial virus assembly in Hep2 cells, the cellular distribution of the complement regulatory protein, CD59 changes and high levels of this cellular protein are incorporated into mature virus filaments. PMID: 15351205
  77. Prostasomes from cancer cells had higher expression of CD59 than those of normal cells. PMID: 15389819
  78. Glycation inactivation of hCD59 leads to increased membrane attack complex deposition may contribute to the extensive vascular pathology that complicates human diabetes. PMID: 15448097
  79. Streptococcus intermedius intermedilysin specifically binds to huCD59 via residues that are the binding site for the C8alpha and C9 complement proteins PMID: 15543155
  80. Both mutant CD59 had the anti-complement activity, which was weakened after glycosylation. PMID: 15766396
  81. CD55-CD59- deficient granulocytes and red blood cells predicts responsse to immunosuppressive agents in aplastic anemia. PMID: 16179371
  82. demonstrated by site-directed mutagenesis that mutated CD59 was more susceptible to glycation-inactivation for hyperglycemia PMID: 16274631
  83. CD59 on target cells enhances the cytotoxicity of natural killer cells, an effect dependent on the glycosylphosphatidylinositol anchor in CD59. PMID: 16493049
  84. The expression of CD59 is up-regulated after atorvastatin treatment independently of blood lipids. PMID: 16563273
  85. Upregulation of CD59 and decay-accelerating factor by atorvastatin in hypoxia prevented deposition of C3, C9 and cell lysis that follows exposure of reoxygenated vascular endothelial cells to serum. PMID: 16859540
  86. CD55/59 deficiency in Campath-treated patients with paroxysmal nocturnal hemoglobinuria msay indicate that deficiency could predispose to a complication of this immunosuppressive therapy. PMID: 16908271
  87. HHV-7 infection causes elevation of the CRPs CD46 and CD59, which may be a possible mechanism for HHV-7 to evade humoral immunity via complement. PMID: 17412968
  88. When compared with previous models of CD59 determined using NMR, some interesting differences are noted, including the position of helix alpha1, which contributes to the binding surface for C8 and C9. PMID: 17505110
  89. These results suggest that IRE1alpha-mediated mRNA cleavage functions even in mammals as a common system to regulate gene expression. PMID: 17585877
  90. Essential for the protection of neurons in the NT2-N teratocarcinoma cell line against complement attack. PMID: 17635812
  91. Electron-density map of recombinant CD59 crystals shows an as yet unidentified small molecule in the predicted C8/C9-binding site. PMID: 17671359
  92. Paroxysmal nocturnal hemoglobinuria (PNH) is characterized by absence of CD59 from the surface of affected granulocytes. PMID: 18158579
  93. up-regulation of CD59 via ERK5/KLF2 activation leads to endothelial resistance to complement-mediated injury and protects from atherogenesis in regions of laminar shear stress PMID: 18362151
  94. erythrocytes are deficient in CD55 and/or CD59 in HIV patients PMID: 18443552
  95. Results indicate that W40 of human CD59 is important to its activity, and prohibition of this site may be a potential way to increase complement activity and to treat tumors PMID: 18445344
  96. Adenovirus-mediated delivery of hCD59 to retinal pigment epithelium, or cornea culturee protects these cells from membrane attach comlpex-mediated ddamage. PMID: 18487376
  97. Complement regulator CD59 protects against atherosclerosis by restricting the formation of complement membrane attack complex. PMID: 19131645
  98. CD59 is trafficked to the cytoplasmic inclusion by a Golgi apparatus-independent pathway during a Chlamydia cell infection. [CD59] PMID: 19168743
  99. A peptide modeled on the CD59-binding site inhibits intermedilysin-mediated haemolysis suggesting that such peptides might be useful in treating infections caused by intermedilysin-producing bacteria. PMID: 19200600
  100. Variants within protectin (CD59) genes linked to an inherited haplotype in a family with coeliac disease PMID: 19254252

Show More

Hide All

Involvement in disease Hemolytic anemia, CD59-mediated, with or without polyneuropathy (HACD59)
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Database Links

HGNC: 1689

OMIM: 107271

KEGG: hsa:966

STRING: 9606.ENSP00000340210

UniGene: Hs.278573

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1