Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

CBR1

Uniprot No.

P16152

Alternative Names

15 hydroxyprostaglandin dehydrogenase [NADP+]; 15-hydroxyprostaglandin dehydrogenase [NADP+]; Carbonyl reductase [NADPH] 1; Carbonyl Reductase 1; CBR 1; CBR1; CBR1_HUMAN; CRN; NADPH dependent carbonyl reductase 1; NADPH-dependent carbonyl reductase 1; Prostaglandin 9 ketoreductase; Prostaglandin 9-ketoreductase; Prostaglandin E(2) 9 reductase; Prostaglandin-E(2) 9-reductase; SDR21C1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-277aa

Target Protein Sequence

SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene encoding the Human CBR1 protein (2-277aa) is incorporated into a plasmid vector to generate recombinant plasmid, which is then introduced into e.coli cells. The e.coli cells containing the recombinant plasmid are selected and cultured under conditions that stimulate the expression of the gene of interest. A N-terminal 6xHis tag is attached to the protein. After expression, affinity purification is employed to isolate and purify the recombinant Human CBR1 protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant Human CBR1 protein, revealing a purity level exceeding 90%.

Target Background

Function

NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.

Gene References into Functions

This study examined the impact of the functional single nucleotide polymorphism CBR1 rs9024 on the bioactivation of loxoprofen in a collection of human liver samples and tumor cell lines. PMID: 29851133
CRB1 is an efficient catalyst for the reduction of glutathionylated aldehydes derived from lipid peroxidation. PMID: 27562619
The ability of human carbonyl reductase 1 to efficiently catalyze the reduction of glutathionylated aldehydes derived from lipid peroxidation, that in the case of glutathionylated-4-hydroxyalkanals is associated to the ability to oxidize the hemiacetal hydroxyl group PMID: 28274719
Data suggest that fatty acids and acyl-CoAs bind competitively with respect to substrate binding to carbonyl reductase 1 (CBR1), an enzyme involved in first-pass drug metabolism in intestinal mucosa; inhibition of CBR1 by these products of digestion may lead to food-drug interactions. PMID: 28450226
AKR1C3 is the primary enzyme and CBR1 is a minor enzyme responsible for warfarin reduction in human liver cytosol. PMID: 27055738
These results suggest that CR1 induces apoptosis by activating the caspase pathway via binding to TNFR1. PMID: 26499922
Results demonstrate a trend toward decreased functional expression of selective hepatic reductases in ESRD livers. PMID: 26282591
Critical insights into the substrate selectivity of hCBR1 and the interaction between hCBR1 and glutathione. PMID: 26381805
Up-Regulation of Carbonyl Reductase 1 Renders Development of Doxorubicin Resistance in Human Gastrointestinal Cancers PMID: 26328486
CBR1 decreases promoted tumor proliferation and growth as well as invasion and metastasis; CBR1 has potential to become a new candidate for molecular targeting therapy. PMID: 25572536
Inhibition of CBR1 may increase the efficacy of daunorubicin in cancer tissue. PMID: 25541467
Protein products of AKR1C1, AKR1C2, AKR7A3, CYP3A4, and carbonyl reductase (CBR1) were found in tumors and those of AKR1C1, AKR7A3, and CBR1 correlated with their transcript levels. PMID: 25526449
we suggest that PEP-1-CBR1 protein may be a therapeutic agent for the treatment of ischemic injuries as well as oxidative-stress-induced cell damage and death. PMID: 24440593
The stimulatory effect of cortisol on CBR1 expression may partly explain the concurrent increases of cortisol and prostaglandin PGF2alpha in human amnion tissue prior to the onset of labor PMID: 24654784
Nrf2 is a novel transcriptional regulator of CBR1 genes in humans. PMID: 23247010
GSNO-induced covalent modification of cysteine residues affects the kinetic mechanism of CBR1. PMID: 23295225
regulation of human CBR1 expression by hsa-miR-574-5p and hsa-miR-921 depends upon rs9024 genotype status PMID: 23133646
This pilot study suggests that CBR1 RNA expression may be helpful in identifying AML patients at risk of developing resistance or toxicity to daunorubicin due to increased formation of daunorubicinol. PMID: 22562609
CBR1 regulates cancer cell invasion in endometrial adenocarcinomas by regulating the epithelial mesenchymal transition PMID: 22542806
Polymorphisms in CBR1 gene did not increase risk of cardiomyopathy after anthracycline treatment of childhood cancers. PMID: 22124095
a physiological role of CBR1, but not for CBR3, in S-nitrosoglutathione reduction and thus ultimately in regulation of NO signaling PMID: 21256830
This protein has been found differentially expressed in thalami from patients with schizophrenia. PMID: 20471030
analysis of the structural basis for substrate specificity in human monomeric carbonyl reductases CBR1 PMID: 19841672
the functional genetic determinant of CBR1 activity toward relevant physiological and pharmacological substrates PMID: 17344335
The functional characterization of the promoter of CBR1 is reported. PMID: 17569794
Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles. PMID: 17697149
These results suggested that hCBR3 and hCBR1 play distinct physiological roles. PMID: 18493841
Human carbonyl reductase 1 is an S-nitrosoglutathione reductase PMID: 18826943
CBR1 polymorphisms have a significant influence on the pharmacokinetics of doxorubicin in Asian breast cancer patients. PMID: 19016765
the nonsynonymous single nucleotide polymorphisms generating mutations OF CBR1 may alter bioavailability of anthracyclines in cancer patients PMID: 19204081

Hide All

Subcellular Location

Cytoplasm.

Protein Families

Short-chain dehydrogenases/reductases (SDR) family

Tissue Specificity

Expressed in kidney (at protein level).

Database Links

HGNC: 1548

OMIM: 114830

KEGG: hsa:873

STRING: 9606.ENSP00000290349

UniGene: Hs.88778

Code	CSB-EP004586HUa0
Abbreviation	Recombinant Human CBR1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004586HUa0 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CBR1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004586HUa0 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CBR1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Carbonyl reductase [NADPH] 1 (CBR1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage