Recombinant Human Carbonyl reductase [NADPH] 1(CBR1)

Code CSB-EP004586HUa0
Product Type Recombinant Protein
Size US$1726
Uniprot No. P16152
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Source E.coli
Gene Names CBR1
Protein Names Recommended name: Carbonyl reductase [NADPH] 1 EC= 1.1.1.184Alternative name(s): 15-hydroxyprostaglandin dehydrogenase [NADP(+)] EC= 1.1.1.197 NADPH-dependent carbonyl reductase 1 Prostaglandin 9-ketoreductase Prostaglandin-E(2)
Expression Region 45-320aa
Tag Info N-terminal 6xHis-tagged
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.
Subcellular Location Cytoplasm
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Database Links

HGNC: 1548

OMIM: 114830

KEGG: hsa:873

STRING: 9606.ENSP00000290349

UniGene: Hs.88778

Related Products

CBR1 Antibodies

CBR1 Antibodies for Homo sapiens (Human)

CBR1 Antibodies for Human

CBR1 Proteins

CBR1 Proteins for Homo sapiens (Human)

CBR1 ELISA Kit

CBR1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.