Recombinant Human Cyclin-A1 Isoform 2 (CCNA1), partial

Code CSB-BP004804HU
Abbreviation Recombinant Human CCNA1 protein, partial
MSDS
Size $400
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
CCN A1; CCNA 1; Ccna1; CCNA1_HUMAN; Cyclin-A1; CyclinA1; G2/mitotic specific cyclin A1; MGC132235; MGC159139
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
1-464aa
Target Protein Sequence
METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.2kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.
Gene References into Functions
  1. Thus, Cyclin A/Cdk1 phosphorylation primes MYPT1 for Plk1 binding. These data demonstrate cross-regulation between Cyclin A/Cdk1-dependent and Plk1-dependent phosphorylation of substrates during mitosis to ensure efficient correction of kinetochore microtubule attachment errors necessary for high mitotic fidelity. PMID: 29154753
  2. Cyclin A1 functions as an oncogene that controls proliferative and survival activities in tumourigenesis and chemoresistance of ovarian cancer. PMID: 27669502
  3. In the bone marrow, cyclin A1 and aromatase enhanced local bone marrow-releasing factors, including androgen receptor, estrogen and matrix metalloproteinase MMP9 and promoted the metastatic growth of prostate cancer cells PMID: 26921336
  4. The data showed that E7 induced CCNA1 methylation by forming a complex with Dnmt1 at the CCNA1 promoter, resulting in the subsequent reduction of expression in cancers. PMID: 26250467
  5. DNA methylation status of key cell-cycle regulators such as CDKNA2/p16 and CCNA1 correlates with treatment response to doxorubicin and 5-fluorouracil in locally advanced breast tumors. PMID: 25294903
  6. These data from results indicated a significant connection of CCNA1 methylation with poor progression in human malignant tumors among both Caucasian and Asian populations. PMID: 25654082
  7. Cyclin A1 immunoexpression is of potential utility in predicting disease progression in patients with pT1 urothelial carcinomas of the bladder PMID: 25039670
  8. HS3ST2 and CCNA1 genes may play important roles in HPV-induced cervical cancer and patients with specific hypermethylated genes may have a greater risk of progressing to invasive cervical cancer. PMID: 25198553
  9. CCNA1 promoter methylation is associated with cervical squamous intraepithelial lesions. PMID: 25292097
  10. High CCNA1 expression is associated with nasopharyngeal carcinoma. PMID: 25265349
  11. Mutations in genes such as AKT2, CCNA1, MAP3K4, and TGFBR1, were associated significantly with Epstein-Barr-positive gastric tumors, compared with EBV-negative tumors. PMID: 25173755
  12. Promoter reporter assays with a series of deletion constructs determined that the DNA element from -102 to -96 bp of the cyclin A1 promoter is responsible for PITX2-induced gene expression. PMID: 24002705
  13. presents CCNA1 and TIMP3 hypermethylation as a helpful tool to identify HNSCC subjects at risk of developing second primary carcinomas PMID: 24359512
  14. Overexpression of cyclin A1 in FSHD indicates cell cycle dysregulation in FSHD and might contribute to clinical symptoms of this disease PMID: 24019929
  15. Nuclear FoxO3a promotes cell cycle progression by transcriptional upregulation of cyclin A1, promoting proliferation of human anaplastic thyroid carcinoma cells. PMID: 22718346
  16. These findings indicate the possible involvement of cyclins A and E in the pathogenesis of malignant melanoma. PMID: 22763964
  17. The organization of actin and cytokeratin cytoskeleton and the expression of TCTP, p53,cyclin A, RhoA and actin in HIO180 non-transformed ovarian epithelial cells, and OVCAR3 and SKOV3 ovarian epithelial cancer cells, was studied. PMID: 23042265
  18. Cyclin A1 as overexpressed in induced lpuripotent stem cells cells compared to embryonic stem cells, suggesting that during reprogramming, cyclin A1 protein expression levels are not set correctly. PMID: 22500553
  19. Cyclin A1 is an important cell cycle regulator with age-related increased expression in tonsils of children. HPV16 induces overexpression of Cyclin A1 in HNSCC despite promoter methylation. PMID: 22712549
  20. Increased cyclin A1 in human bladder cancer cells may be regulated by activity of the USP2a deubiquitinase. PMID: 22370483
  21. Cyclin-A1 is the first prototypic leukemia-testis-antigen to be expressed in acute myeloid leukemia leukemic stem cells. PMID: 22529286
  22. Oxidized low density lipoprotein induces cyclin A synthesis in a process involving ERK, JNK and NFkappaB PMID: 21764057
  23. The integrated form of HPV might lead to CCNA1 promoter methylation in cervical cancer by some mechanisms. PMID: 21412159
  24. CCNA1 methylation may play a crucial role in HPV16-induced carcinogenesis of HNSCC independently of p53 PMID: 21563216
  25. anti-oncogenic role of miR-372 may be through control of cell growth and cell cycle progression by down-regulating the cell cycle genes CDK2 and cyclin A1 PMID: 21646351
  26. mRNA expression of cyclin A1 in myelodysplastic syndrome patients is higher than in normal controls. PMID: 19379570
  27. An increase in cyclin A1 expression was the only differentially expressed cell cycle regulatory gene found. Greater cyclin A protein levels were consistently observed in cells with active IRE1alpha and were dependent on XBP-1. PMID: 20013084
  28. revealed that KDM8 occupies the coding region of cyclin A1 and directly regulates transcription. PMID: 20457893
  29. These results indicate that HIV-1 integrase is required during uncoating for maintaining CypA-capsid protein interaction, which promotes optimal stability of the viral core. PMID: 20219923
  30. Methylation of CCNA1 in cervical scrapings is strongly associated with high-grade cervical intraepithelial neoplasia and cervical cancer. PMID: 19843677
  31. Four point mutations, c.321T>C, IVS3 +32G>C, IVS5+38A>G and c.1158G>A, are not associated with spermatogenesis impairment. PMID: 19886767
  32. the level of cyclin A1 mRNA expression predicts meiotic disorders during spermatogenesis PMID: 12121569
  33. CCNA1 had successive increases in its promoter activity during spermatgogensis in transgenic mice. PMID: 12579332
  34. study provides evidence that the cyclin A1-cyclin dependent kinase 2 complex plays a role in several signaling pathways important for cell cycle control and meiosis PMID: 15159402
  35. Cyclin A1 methylation was inversely related to p53 mutational status in primary tumors, and forced expression of cyclin A1 resulted in robust induction of wild-type p53 in HNSCC cell lines. PMID: 15342377
  36. These findings establish a novel function for cyclin A1 and CDK2 in DNA double strand break repair following radiation damage. PMID: 15456866
  37. these analyses demonstrate that cyclin A1 contributes to G1 to S cell cycle progression in somatic cells. PMID: 15829981
  38. cyclin A1 mediates VEGF expression in cooperation with Rb- and androgen-dependent pathways in prostate cancer PMID: 16007189
  39. Significant tumour specific methylation of cyclin A1 promoter seen in oral sqmaous cell carcinoma PMID: 16449996
  40. The data implicate cyclin A1 as a downstream player in p53-dependent apoptosis and G2 arrest. PMID: 16799873
  41. Mip/LIN-9 is required for the expression of B-Myb, and both proteins collaborate in the control of the cell cycle progression via the regulation of S phase and cyclin A, cyclin B, and CDK1 PMID: 17098733
  42. these analyses demonstrate that cyclin A1 exerts antiapoptotic functions by interacting with retinoblastoma and Ku proteins in leukemia cells. PMID: 17455244
  43. Over expression of H179Y-mutant p53 promoted G1 to S phase transition with enlarged cell size and increased cyclin A1 and Cdk4 expression in HELF cells. PMID: 17530187
  44. G2 phase cyclin A/cdk2 controls the timing of entry into mitosis by controlling the subsequent activation of cyclin B/cdk1, but also has an unexpected role in coordinating the activation of cyclin B/cdk1 at the centrosome and in the nucleus PMID: 18372919
  45. Cyclin A1 contributes to prostate cancer invasion by modulating the expression of MMPs and VEGF and by interacting with AR (androgen receptor). PMID: 18612129
  46. The CCNA1, CCNB1, CCNB2, PRM1, and PRM2 messenger RNA transcript ratios were significantly decreased in patients with spermatogenic disorders. Transcript ratios in patients with successful sperm retrieval were higher than with failed sperm retrieval. PMID: 18692784
  47. Results suggest that cyclin A1 protein is stabilized via post-transcriptional modification in response to apoptosis induced by staurosporine or TNFalpha. PMID: 18787932
  48. Cyclin A1- and cyclin A2-containing CDK complexes were compared in vitro by determining kinetic constants and by examining the complexes for their ability to phosphorylate pRb and p53. PMID: 19056339
  49. Study shows that transcription corepressor CtBP2 directly binds acinus, which is regulated by nerve growth factor (NGF), inhibiting its stimulatory effect on cyclin A1, but not cyclin A2, expression in leukemia. PMID: 19668232

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Cyclin family, Cyclin AB subfamily
Tissue Specificity
Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.
Database Links

HGNC: 1577

OMIM: 604036

KEGG: hsa:8900

STRING: 9606.ENSP00000255465

UniGene: Hs.417050

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*