Recombinant Human Cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3 (CDKN2A)

In Stock
Code CSB-EP005089HU
Abbreviation Recombinant Human CDKN2A protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Cyclin-dependent kinase 4 inhibitor A;Multiple tumor suppressor 1;p16-INK4a
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-156aa
Target Protein Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein.
Gene References into Functions
  1. Increased expression of epithelial and stromal p16(CDKN2A) in all grades of cervical intraepithelial neoplasia and cancer PMID: 30059872
  2. Data indicate a cell regulatory mechanism through which lysine-specific demethylase 2B (KDM2B) promotes triple negative breast cancer (TNBC) cell proliferation by binding to the promoters of cell cycle inhibitors p15INK4B, p16INK4A, and p57KIP2. PMID: 30060056
  3. results suggest that lower P16(INK4A) expression associated with highercancer stem cells (CSCs) markers predicts poor prognostic outcomes and is a promising target in patients with cervical cancer. PMID: 30150594
  4. In this review, we discuss recent findings on the regulation of p16-INK4a by covalent modifications at both transcriptional and post-translational levels. PMID: 30482142
  5. Knockdown of cyclin dependent kinase inhibitor 2A (p16INK4A) in cardiac stem/progenitor cell (hCPC) reverses the senescent phenotype and has an antioxidant effect on aging hCPCs via NF-KAPPA B (NF-kB) signaling. PMID: 29675777
  6. CDKN2A methylation is involved in the carcinogenesis, progression, and metastasis of head and neck squamous cell carcinoma; could be a potential diagnostic and prognostic biomarker (Meta-Analysis) PMID: 30355925
  7. CDKN2A overexpression was cell-type dependent in adenoid cystic carcinoma in the lacrimal gland, while HPV infection was negative. PMID: 29430168
  8. Study reveals the novel function of NOX4 in reprogramming aerobic glycolysis initiated by activated Kras and inactivated p16 in pancreatic ductal adenocarcinoma. PMID: 28232723
  9. we were able to document the loss of p16 protein expression and CDKN2A gene aberrancy in a subset of conventional and fibrosarcomatous dermatofibrosarcoma protuberans cases PMID: 29743142
  10. ARF is a tumor suppressor protein that has a pivotal role in the prevention of cancer development through regulating cell proliferation, senescence, and apoptosis. As a factor that induces senescence, the role of ARF as a tumor suppressor is closely linked to the p53-MDM2 axis, which is a key process that restrains tumor formation. Review. PMID: 29665672
  11. p16/Ki-67 dual immunostaining had comparable sensitivity and improved specificity in screening high-grade cervical intraepithelial neoplasm (HGCIN) or CC when compared with hrHPV detection. Further studies may be beneficial to assess the efficacy of this novel biomarker, which can be potentially used as one of the initial screening assays. PMID: 30249873
  12. Findings outlined in the current study demonstrated that the inhibition of P16 decreased the growth and metastasis potential of BC cells by inhibiting IL-6/JAK2/STAT3 signaling. PMID: 29388151
  13. Loss of P14ARF expression is associated with small intestinal adenocarcinoma. PMID: 30375264
  14. These results...suggest that nucleolar p14ARF can be used as early prognostic marker in chronic liver disease to reliably identify patients with high risk for developing liver cancer PMID: 29228217
  15. a antagonizing mechanism coordinating Arg 138 methylation and Ser 140 phosphorylation to regulates p16 function as well as cellular apoptosis and senescence. PMID: 28120917
  16. The aim of this study was to investigate the expression of p16 and SATB1 proteins in regard to expression of the Ki-67 antigen and available clinicopathological data (i.a. receptor status, staging and grading PMID: 29936452
  17. rognostic impact of p16 can be emphasized in a subgroup of oropharyngeal squamous cell carcinoma (OSCC) patients undergoing surgery. Surgery with sufficient surgical margin may be chosen as the first treatment for HPV-negative OSCC in some cases PMID: 29936482
  18. Low P16INK4A expression is associated with laryngeal squamous cell carcinomas. PMID: 30275203
  19. These results confirm that CDKN2A is a tumor suppressor gene driving human cancer development by inducing cell aneuploidy and cell cycle up-regulation PMID: 30136875
  20. This study demonstrated that p16/Ki-67 dual staining represents an effective method for cervical cancer screening. Application of this method could lead to a reduction of unnecessary colposcopy referrals and misdiagnosis. PMID: 29758205
  21. Non-significant association was seen in the two single nucleotide polymorphisms (SNPs) of CDKAL1 (rs7754840) and CDKN2A/2B (rs10811661) with gestational diabetes mellitus (GDM). PMID: 29544538
  22. In conclusion, this meta-analysis showed that decreased p16(INK4a) expression is associated with lower overall survival rate in patients with STS, and it is an effective biomarker of prognosis. PMID: 29798963
  23. CDKN2A mutation carriers presented more atypical naevi, multiple melanomas, and basal cell carcinoma. PMID: 29405243
  24. hsa_circ_0014717 acts as a potential tumor suppressor that inhibits colorectal cancer growth, partly at least, through upregulating p16 expression. PMID: 29571246
  25. Anti-E2, -L1, and -p16(INK4A) antibodies in sera were determined by western blot. Among 116 samples, 69 (60%) were HPV DNA-positive. Percentages seropositive for anti-E2, -L1, and -p16(INK4A) antibodies were 39.6, 22.4, and 23.3%, respectively. PMID: 29744680
  26. p16 represents a useful supplementary marker for diagnosis of SCLC, even in cases where only cytological material is available PMID: 29566943
  27. this study shows that basaloid squamous cell carcinoma and basal cell carcinoma of the head and neck can be readily distinguished by a limited panel consisting primarily of EMA, and supported by SOX2 and p16 PMID: 27438511
  28. p16 IHC is an independent prognostic biomarker in pleural mesothelioma PMID: 28889523
  29. It plays a role for small intestine-specific gene regulation and alterations of the CDKN2A/CDKN2B locus could affect the pathophysiology of inflammatory bowel disease. PMID: 29063720
  30. p16/Ki-67 dual staining can increase the efficiency of screening methods for cervical cancer. PMID: 29895125
  31. The methylation of the p16 gene promoter could significantly reduce p16 expression, losing its tumor suppressor activity and promoting the development of cervical cancer. PMID: 28617556
  32. Co-administration of VOR did not increase the overall response rate (P = 0.84) or overall survival (OS; P = 0.32). Specifically, no benefit was identified in either de novo or relapsed AML. Mutations in the genes CDKN2A (P = 0.0001), IDH1 (P = 0.004), and TP53 (P = 0.003) were associated with reduced OS PMID: 28765326
  33. The increased expression of p16ink4a may affect the activity of Wnt/betacatenin signaling through modulation of the expression of betacatenin. PMID: 29207089
  34. Alterations in chromatin-remodeling genes and CDKN2A contribute to metastasis of pancreatic neuroendocrine tumors. PMID: 29486199
  35. data suggest that a P16-dependent pathway drives the induction of cellular senescence in dental follicle cells. PMID: 28770470
  36. rs2518719 is a pleiotropic CDKN2A variant associated with the risk of developing pancreatic neuroendocrine tumors PMID: 28008994
  37. Hypermethylation of p14 appears to be an important event in the development of mucoepidermoid carcinoma. High frequency of gene hypermethylation and high incidence of methylation at multiple sites point to the importance of epigenetic phenomena in the pathogenesis of MECs, although with modest impact on clinical parameters. PMID: 29079368
  38. perinatal methylation at CDKN2A is associated with childhood bone development. PMID: 28419547
  39. Final follow-up showed 45 cases of spontaneous lesion regression and 42 cases of persistence with absence of protein p164NK4a in all of them PMID: 29787011
  40. CDKN2A/p16 frequently alters in oral cancer progression with a deletion/loss of function in the recurrent cases displaying its role in aiding several molecular events for the malignant transformations occurring throughout disease progression PMID: 28939073
  41. Data suggest that stromal cyclin-dependent kinase inhibitor p16 (p16) expression is involved in the development and progression of gastric-type mucinous carcinoma (MC-G). PMID: 29848709
  42. Report p16 immunohistochemistry in oropharyngeal squamous cell carcinoma and high-risk human papillomavirus RNA status. PMID: 28621317
  43. CDKN2A/B locus SNPs may impact type 2 diabetes risk by modulating islet gene expression and beta-cell proliferation. PMID: 29432124
  44. miR663 is upregulated in the serum of patients with NPC and NPC cells, and may promote the proliferation and cell cycle progression of NPC cells, at least in part through direct targeting of CDKN2A. PMID: 28765905
  45. Studied CDKN2A/B gene variants and association with increased risk of breast cancer; results show a correlation between the genetic polymorphism, rs10811661, in CDKN2A/B gene and breast cancer. PMID: 28276595
  46. p16 inhibits tenogenic differentiation of tendon stem/progenitor cells via microRNA signaling pathways. PMID: 29036495
  47. Oncogenic signaling induces ARF, and ARF further promotes p53 activation to inhibit proliferation. PMID: 28484034
  48. Data show that p16(INK4a) mRNA expression level was significantly negatively associated with handgrip strength in men but not in women. PMID: 27549351
  49. Significant immunoreactivity for p16(INK4a) was present in about one-fifth of the samples and figured as a surrogate marker of high-risk human papillomavirus infection in squamous cell carcinoma of the nasal vestibule. PMID: 28371015
  50. The p16-/HPV L1- pattern was significantly associated with the regression of CIN1. Moving from cervical intraepithelial neoplasia 1 (CIN1) to CIN2+ over time, p16+/HPV L1+ decreased, and p16+/HPV L1- increased. PMID: 28277314

Show More

Hide All

Involvement in disease
Melanoma, cutaneous malignant 2 (CMM2); Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome (FAMMMPC); Melanoma-astrocytoma syndrome (MASTS)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
CDKN2 cyclin-dependent kinase inhibitor family
Tissue Specificity
Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific.
Database Links

HGNC: 1787

OMIM: 155601

KEGG: hsa:1029

STRING: 9606.ENSP00000394932

UniGene: Hs.512599

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*