Recombinant Human Cystathionine beta-synthase (CBS), partial

In Stock
Code CSB-YP004589HU1
Abbreviation Recombinant Human CBS protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-413aa
Target Protein Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Cystathionine beta-synthase (CBS) is produced in a yeast expression system and includes a partial sequence covering amino acids 1-413. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. Purity levels appear to exceed 90%, as confirmed by SDS-PAGE, suggesting this represents a high-quality reagent that may be suitable for various research applications.

Cystathionine beta-synthase (CBS) is an enzyme that plays a critical role in the transsulfuration pathway, helping to regulate homocysteine levels in the body. This enzyme catalyzes the conversion of homocysteine to cystathionine, a crucial step in sulfur amino acid metabolism. CBS has drawn considerable attention in biomedical research due to its involvement in various physiological processes and its connection to metabolic disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant human CBS is produced in a yeast expression system as a partial fragment (1-413aa) with an N-terminal 6xHis-tag. CBS is a complex homotetrameric enzyme that requires proper folding, heme cofactor incorporation, and pyridoxal phosphate (PLP) binding for its catalytic activity. While yeast expression systems provide eukaryotic folding machinery that can support disulfide bond formation and some post-translational modifications, this partial fragment lacks the C-terminal regulatory domain (full-length CBS is 551aa), which is essential for proper tetramerization and regulatory function. The protein may not form the active tetrameric structure or properly incorporate essential cofactors. Purity >90% by SDS-PAGE under denaturing conditions does not confirm native folding or bioactivity. No validation data (e.g., enzymatic activity assays, cofactor analysis) are provided. Therefore, while yeast expression offers advantages over prokaryotic systems, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. In Vitro Enzyme Kinetics and Biochemical Characterization Studies

CBS requires tetramerization and cofactor incorporation for activity; a partial fragment likely lacks proper function. If the recombinant CBS fragment is correctly folded and properly incorporates heme and PLP cofactors, it could be used for limited enzyme kinetics studies. However, if misfolded or lacking cofactors (likely without the C-terminal domain), activity assays would yield invalid results. The partial nature (missing regulatory domain) means any kinetic parameters measured would not reflect the physiological behavior of full-length CBS.

2. Protein-Protein Interaction Studies

The truncated form may not represent native interaction networks due to missing domains. If properly folded, the His-tagged CBS fragment could be used for interaction studies, but the missing C-terminal domain may eliminate key regulatory interactions. If misfolded, interaction domains may be altered, leading to non-specific binding or failure to identify genuine partners.

3. Antibody Development and Validation

Antibodies can be produced against linear sequences, but may miss full-length specific epitopes. This application is suitable, as antibody generation primarily relies on linear epitope recognition. The defined fragment provides specific epitopes for antibody production. However, antibodies generated against this partial fragment may not recognize conformational epitopes dependent on the full-length tetrameric structure.

4. Structural and Biophysical Analysis

Partial fragments provide limited structural insights for complex multidomain proteins. If properly folded, the fragment could provide insights into the N-terminal catalytic domain structure. However, the missing C-terminal domain limits understanding of full-length CBS architecture and regulation. If misfolded, structural data would misrepresent the native protein.

Final Recommendation & Action Plan

This yeast-expressed partial CBS fragment requires rigorous validation before functional applications due to the critical importance of the missing C-terminal regulatory domain for proper tetramerization, cofactor incorporation, and enzymatic activity. Recommended actions: (1) Validate folding through biophysical methods (circular dichroism, size-exclusion chromatography to check oligomeric state); (2) Test enzymatic activity with proper substrates and cofactors; (3) For reliable functional studies, use full-length CBS expressed in mammalian systems that can properly incorporate heme and PLP cofactors; (4) Antibody development can proceed but validate against full-length protein; (5) Structural and interaction studies should be interpreted with caution due to the truncated nature. Always include positive controls with validated full-length CBS when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Involvement in disease
Cystathionine beta-synthase deficiency (CBSD)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cysteine synthase/cystathionine beta-synthase family
Tissue Specificity
In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Database Links

HGNC: 1550

OMIM: 236200

KEGG: hsa:102724560

UniGene: Hs.533013

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*