Recombinant Human Cystathionine beta-synthase (CBS), partial

In Stock
Code CSB-YP004589HU1
Abbreviation Recombinant Human CBS protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CBS
Uniprot No.
Research Area
Metabolism
Alternative Names
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-413aa
Target Protein Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Cystathionine beta-synthase (CBS) is produced in a yeast expression system and includes a partial sequence covering amino acids 1-413. The protein carries an N-terminal 6xHis tag, which makes purification and detection more straightforward. Purity levels appear to exceed 90%, as confirmed by SDS-PAGE, suggesting this represents a high-quality reagent that may be suitable for various research applications.

Cystathionine beta-synthase (CBS) is an enzyme that plays a critical role in the transsulfuration pathway, helping to regulate homocysteine levels in the body. This enzyme catalyzes the conversion of homocysteine to cystathionine, a crucial step in sulfur amino acid metabolism. CBS has drawn considerable attention in biomedical research due to its involvement in various physiological processes and its connection to metabolic disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. In Vitro Enzyme Kinetics and Biochemical Characterization Studies

This recombinant CBS protein offers researchers a way to investigate the fundamental enzymatic properties of cystathionine beta-synthase under controlled laboratory conditions. Scientists can conduct substrate specificity assays using homocysteine and serine as substrates to measure cystathionine formation. The N-terminal 6xHis tag simplifies protein purification and quantification, which should allow for precise concentration-dependent activity measurements. Such studies may help advance our understanding of the basic biochemical parameters of CBS enzyme function, including optimal pH, temperature, and cofactor requirements.

2. Protein-Protein Interaction Studies

The His-tagged CBS protein can function as bait in pull-down assays to identify and characterize potential binding partners or regulatory proteins that interact with cystathionine beta-synthase. The tag allows for immobilization on nickel-affinity matrices, enabling the capture of interacting proteins from cell lysates or purified protein libraries. This approach might help reveal cellular pathways and regulatory networks involving CBS. The high purity level appears to minimize background interference in interaction studies, though some non-specific binding may still occur.

3. Antibody Development and Validation

This purified recombinant CBS protein can serve as an antigen for generating specific antibodies against human cystathionine beta-synthase. The high purity and defined amino acid sequence (1-413aa) make it a reasonable candidate for immunization protocols in antibody production. The protein can also function as a positive control and standard for validating antibody specificity in Western blotting, ELISA, and immunoprecipitation experiments. Researchers may find the His tag useful in tag-specific detection assays during antibody characterization, though cross-reactivity with the tag itself could potentially complicate some analyses.

4. Structural and Biophysical Analysis

The recombinant CBS protein shows promise for biophysical studies investigating protein folding, stability, and conformational changes under various conditions. Techniques such as circular dichroism spectroscopy, dynamic light scattering, and thermal stability assays could provide insights into the protein's structural properties. The yeast expression system and high purity level suggest this protein may be well-suited for detailed structural characterization studies. These analyses might contribute to a better understanding of structure-function relationships in cystathionine beta-synthase, though it's worth noting that the truncated nature of this construct (amino acids 1-413) could limit some structural interpretations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Involvement in disease
Cystathionine beta-synthase deficiency (CBSD)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cysteine synthase/cystathionine beta-synthase family
Tissue Specificity
In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Database Links

HGNC: 1550

OMIM: 236200

KEGG: hsa:102724560

UniGene: Hs.533013

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*