Recombinant Human Cystathionine beta-synthase (CBS), partial

Code CSB-EP004589HU1
Abbreviation Recombinant Human CBS protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CBS
Uniprot No.
Research Area
Metabolism
Alternative Names
AI047524; AI303044; Beta thionase; Beta-thionase; Cbs; Cbs cystathionine beta-synthase; CBS_HUMAN; Cystathionine beta synthase; Cystathionine beta-synthase; EC 4.2.1.22; HIP 4; HIP4; Methylcysteine synthase; MGC18856; MGC18895; MGC37300; OTTHUMP00000109416; OTTHUMP00000109418; Serine sulfhydrase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-413aa
Target Protein Sequence
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
61.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human CBS protein is encoded by the gene of CBS (1-413aa). The gene of CBS was cloned in a system (E.coli) that supported the expression of CBS. Modification of CBS by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 6xHis-SUMO tag in the production. The purity is 90% determined by SDS-PAGE.

CBS is a protein coding gene that encodes Cystathionine beta-synthase. According to some studies, CBS may have the following features.
Commonly used pharmacological inhibitors are selective for cystathionine β synthase (CBS) and cystathionine γ lyase (CSE). The CBS domain forms an energy sensor module, and its binding to adenosine ligands is disrupted by disease mutations. Anatomical differences between CBS-cortical basal degeneration and CBS-Alzheimer's disease. Cysteine β synthase (CBS) contributes to the progression and drug resistance of advanced ovarian cancer. The expression of cystathionine beta synthase (CBS) gene during mouse development and its immunolocalization in the adult brain. The function and structure of the CBS domain from the CLC chloride channel are preserved. The overproduction of H2S produced by CBS inhibits mitochondrial complex IV and inhibits the oxidative phosphorylation of Down syndrome.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
Involvement in disease
Cystathionine beta-synthase deficiency (CBSD)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Cysteine synthase/cystathionine beta-synthase family
Tissue Specificity
In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Database Links

HGNC: 1550

OMIM: 236200

KEGG: hsa:102724560

UniGene: Hs.533013

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*