Recombinant Human Cystathionine beta-synthase(CBS),partial

Code CSB-EP004589HU1
Product Type Recombinant Protein
Size US$1726
Uniprot No. P35520
Relevance Only known pyridoxal phosphate-dependent enzyme that contains he. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Beta-thionase;Serine sulfhydrase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR
Research Area Metabolism
Source E.coli
Gene Names CBS
Expression Region 1-413aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 61.4kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine
Involvement in disease Cystathionine beta-synthase deficiency (CBSD)
Subcellular Location Cytoplasm, Nucleus
Protein Families Cysteine synthase/cystathionine beta-synthase family
Tissue Specificity In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Database Links

HGNC: 1550

OMIM: 236200

KEGG: hsa:102724560

UniGene: Hs.533013

Related Products

CBS Antibodies

CBS Antibodies for Homo sapiens (Human)

CBS Antibodies for Human

CBS Proteins

CBS Proteins for Homo sapiens (Human)

CBS ELISA Kit

CBS ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.