Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Bone proteoglycan II; CSCD; DCN; DCN protein; Decorin; Decorin proteoglycan; Dermatan sulphate proteoglycans II ; DKFZp686J19238; DSPG 2; DSPG2; PG 40; PG II; PG S2; PG-S2; PG40; PGII ; PGS 2; PGS2; PGS2_HUMAN; Proteoglycan core protein ; SLRR1B; Small leucine rich protein 1B
Species
Homo sapiens (Human)
Expression Region
20-359aa
Target Protein Sequence
QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To prepare this Recombinant Human DCN protein, the recombinant DNA was required, which was generated by fusing the DCN gene with N-terminal 6xHis tag sequence. Once the recombinant DNA was amplified and purified, a protein expression system, E.coli, was needed for this DCN protein production. After purification, a premium DCN recombinant proteinwas obtained. According to SDS-PAGE, its purity turns out to be 90%+.
DCN (also known as SLRR1B) is a gene that instructs to make a protein named Decorin (also called bone proteoglycan II, PG-S2 or PG40). Decorin is an archetypal member belonging to the small leucine-rich proteoglycan gene family. It consists of a 36-kDa protein core with a single glycosaminoglycan (GAG) chain of chondroitin sulfate or dermatan sulfate. This protein has a broad binding repertoire that encompasses matrix structural components, such as collagens, and growth factors. More and more studies have revealed that stromal decorin has an inherent proclivity to directly bind and down-regulate several receptor tyrosine kinases in tumor microenvironment.
