Recombinant Human Decorin (DCN), partial

In Stock
Code CSB-EP006554HU1
Abbreviation Recombinant Human DCN protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Bone proteoglycan II; CSCD; DCN; DCN protein; Decorin; Decorin proteoglycan; Dermatan sulphate proteoglycans II ; DKFZp686J19238; DSPG 2; DSPG2; PG 40; PG II; PG S2; PG-S2; PG40; PGII ; PGS 2; PGS2; PGS2_HUMAN; Proteoglycan core protein ; SLRR1B; Small leucine rich protein 1B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-359aa
Target Protein Sequence
QQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To prepare this Recombinant Human DCN protein, the recombinant DNA was required, which was generated by fusing the DCN gene with N-terminal 6xHis tag sequence. Once the recombinant DNA was amplified and purified, a protein expression system, E.coli, was needed for this DCN protein production. After purification, a premium DCN recombinant proteinwas obtained. According to SDS-PAGE, its purity turns out to be 90%+.

DCN (also known as SLRR1B) is a gene that instructs to make a protein named Decorin (also called bone proteoglycan II, PG-S2 or PG40). Decorin is an archetypal member belonging to the small leucine-rich proteoglycan gene family. It consists of a 36-kDa protein core with a single glycosaminoglycan (GAG) chain of chondroitin sulfate or dermatan sulfate. This protein has a broad binding repertoire that encompasses matrix structural components, such as collagens, and growth factors. More and more studies have revealed that stromal decorin has an inherent proclivity to directly bind and down-regulate several receptor tyrosine kinases in tumor microenvironment.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May affect the rate of fibrils formation.
Gene References into Functions
  1. Systemic rAAV-DCN in neuroblastoma-grafted nude mice inhibited stabilin-1. PMID: 28631095
  2. Our data suggests that the endometrium of patients with polycystic ovary syndrome (PCOS) exhibits higher expressions of decorin and lumican than that of healthy control women in the proliferative phase of the menstrual cycle. It is then possible that this proteoglycan excess may interfere with normal endometrial hemostasis in PCOS. PMID: 28789706
  3. The negative correlation between miR-200c and DCN (Decorin) was calculated in colorectal carcinoma, indicating that DCN could be a potential target of miR-200c. PMID: 28567416
  4. Genetic screening showed a deletion of chromosome 12q21.33-q22 containing the identified four small leucine-rich proteoglycans (SLRP's) associated with this particular dystrophy. PMID: 27096414
  5. Data suggest that PEG3 is required for TFEB induction and nuclear translocation in a VEGFR2- and AMPK-dependent manner for decorin/decorin receptor-evoked autophagy. (PEG3 = paternally expressed 3 protein; TFEB = transcription factor EB; VEGFR2 = vascular endothelial growth factor receptor-2; AMPK = AMP-activated protein kinase) PMID: 28798237
  6. Decorin exhibits promiscuity in its ability to alter tumorigenesis via regulation of angiogenesis, autophagy, and inflammation. (Review) PMID: 27860287
  7. Quantitative polymerase chain reaction for messenger RNA expression from tissue specimens revealed significantly higher expression of Biglycan (p = 0.0008) and Lumican (p = 0.01) and lower expression of Decorin (p < 0.0001) in urothelial carcinoma of bladder PMID: 28459201
  8. decorin can alter the bioactivity of TGF-beta2 on human myoblast migration PMID: 27644884
  9. A Finnish cohort of 336 subjects with diagnosed hypertension and 444 controls was analyzed. Samples were genotyped for decorin rs7308752 and rs516115 polymorphisms. The GG genotype of the decorin polymorphism rs7308752 (A>G) and the CC genotype of the rs516115 (T>C) are associated with decreased plasma resistin levels. These two decorin polymorphisms appear to have biological relevance in human vascular pathophysiology. PMID: 27315044
  10. analysis of decorin and lumican expression in fibroblasts correlated with palmoplantar collagen bundle size PMID: 26663310
  11. via gain-of-function analyses, DCN overexpression could inhibit renal cell carcinoma (RCC) cell proliferation and metastasis in vitro and vivo. At the mechanism level, we found that an ectopic expression of DCN significantly upregulated P21 and E-cadherin expression. Altogether, these results revealed that DCN is a tumor suppressor in RCC, and it could serve as a potential therapeutic target in patients with RCC. PMID: 26547587
  12. A synthetic peptide corresponding to this decorin region dose-dependently inhibited the response to myostatin in cardiomyocytes PMID: 27559042
  13. increased blood DCN levels could be a candidate biomarker for PE. PMID: 26554635
  14. An emerging concept that multiple proteases, especially those produced by inflammatory cells, are capable of cleaving DCN suggests that native DCN could be inactivated in a number of pathological inflammatory conditions PMID: 26697491
  15. Decorin plays a key role in the maintenance of the order in the normal corneal extracellular matrix. PMID: 26828927
  16. Compared with bone graft and marrow cavity contents, sticking scars had the highest expression of BMP-2 while bone grafts had the highest expression of DCN. PMID: 26400336
  17. Defective Proteolytic Processing of Fibrillar Procollagens and Prodecorin Due to Biallelic BMP1 Mutations Results in a Severe, Progressive Form of Osteogenesis Imperfecta. PMID: 25656619
  18. Data show that decorin is not only associated with angiogenesis, but it plays a causal role in this process. Also, depending on the molecular microenvironment where angiogenesis is induced, decorin can either promote or inhibit angiogenesis. [review] PMID: 25661523
  19. findings indicate that decorin may indirectly act as an antagonist to MM cell survival and that the interplay between MM and decorin may be an important target to explore in manipulating the tumor niche to inhibit tumorigenesis PMID: 25407518
  20. decorin expression and immunoreactivity in normal and malignant human colorectal tissue PMID: 26001829
  21. Our results reveal the molecular details of the periostin-decorin complex in both phyllodes tumor tissues and breast cancer cells; this interaction may represent a novel target for anti-cancer therapy PMID: 25400079
  22. A role for decorin and p-Smad-2 in the pathophysiology of fetal membranes and adverse pregnancy outcomes. PMID: 25232019
  23. decorin plays crucial roles in non-small-cell lung cancer against carcinogenesis and progression. PMID: 25524578
  24. The results suggest that regions within decorin is associated with ACL injury susceptibility and that genetic sequence variability within genes encoding proteoglycans may potentially modulate the ligament fibril properties. PMID: 24552666
  25. immunolocalization of decorin and biglycan in samples of first-trimester and term placentas, placenta accreta, invasive mole, and choriocarcinoma PMID: 24117774
  26. The targets of DCN include genes that play important roles in angiogenesis and cellular growth and may contribute to the pathogenesis of fetal growth restriction. PMID: 24947404
  27. DCN is a key regulator for chemoresistant mechanisms. PMID: 25550184
  28. Results demonstrate that DCN, a small leucine-rich proteoglycan, localizes to subregions of pathologically thickened arteries affected by CADASIL PMID: 25026535
  29. Lumican, decorin and dermatopontin are differentially expressed and may serve as biomarkers for metastatic and recurrent Giant cell tumor of bone PMID: 25304290
  30. Decorin differentially modulates the activity of insulin receptor isoform A ligands. PMID: 24389353
  31. AMPK is downstream of VEGFR2 and inhibition of AMPK signaling abrogated decorin-evoked autophagy. PMID: 24472739
  32. Decorin induced by dienogest appears to play a crucial role in suppressing endometriosis by exerting anti-proliferative effects and inducing cell cycle arrest. PMID: 25244916
  33. decorin secreted from myotubes in response to exercise is involved in the regulation of muscle hypertrophy and hence could play a role in exercise-related restructuring processes of skeletal muscle. PMID: 24996176
  34. Periductal myxoid stroma and reduced periductal decorin expression seem to be prognostic for overall ipsilateral locoregional recurrence in ductal carcinoma in situ PMID: 23889174
  35. The results of our study showed that the presence of increased DCN levels in women with fetal growth restriction could contribute to pathogenesis of the disease. PMID: 24256371
  36. we identified the methylated +58CpG in DCN 5'-UTR associated with reduced expression of DCN mRNA, thereby downregulating E-cadherin in NSCLC cells with high metastatic potential. PMID: 24424784
  37. We present the clinical, histopathological, and molecular genetic assessment of a Chinese family with congenital stromal corneal dystrophy in which a novel DCN mutation was identified. PMID: 24413633
  38. human bladder cancer cells in vitro were negative for decorin expression. PMID: 24146840
  39. findings have shown that MMP-8 is able to modify the metastatic potential of breast cancer cells because of its ability to proteolytically cleave decorin and regulate miR-21 levels PMID: 23851508
  40. Overexpress decorin together with angiogenesis- and adhesion/migration-related genes, and that decorin overexpression in the human bladder carcinoma cell line TCCSUP is required for efficient invasiveness in vitro. PMID: 24142880
  41. decorin-mediated inhibition of cholangiocarcinoma cell growth, migration, and invasion and promotion of cell apoptosis might be through regulation of the expression of E-cadherin in vitro. PMID: 24272200
  42. Polymorphonuclear cell proteases, especially neutrophil elastase, degrade decorin, and this degradation renders collagen fibrils more susceptible to MMP-1 cleavage. PMID: 24023624
  43. Micro vessel density and VEGF-A expression were significantly associated with reduced decorin expression in tumor stroma suggesting, decorin as angiogenic modulator in oral squamous cell carcinomas. PMID: 24152495
  44. Both lumican and decorin are involved in collagen fibrillogenesis and stability. PMID: 23747391
  45. This age-dependent alteration of decorin GAG may contribute to skin fragility of elderly people. PMID: 23939413
  46. Decorin lacking c-terminal repeat is retained intracellularly, its accumulation triggering endoplasmic reticulum stress that results in abnormal synthesis and secretion, leading to congenital stromal corneal dystrophy. PMID: 23685109
  47. decorin induced VEGFR2-dependent mitochondrial fragmentation and loss of mitochondrial membrane potential PMID: 23798385
  48. The expression of collagen type IalphaI, collagen type III and decorin could be detected in tenocyte-like cell cultures using both enzymatic digestion and cell migration methodology. PMID: 22871215
  49. immunohistochemistry. Gene expression from mRNA extracted from cartilage showed high levels of decorin expression, likely associated with the large, complex tubular structures running through this cartilage type. PMID: 22490077
  50. The concentration of aggrecan, biglycan, and decorin was determined in six regions of the human supraspinatus tendon. PMID: 22329809

Show More

Hide All

Involvement in disease
Corneal dystrophy, congenital stromal (CSCD)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Database Links

HGNC: 2705

OMIM: 125255

KEGG: hsa:1634

STRING: 9606.ENSP00000052754

UniGene: Hs.156316

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*