Recombinant Human E3 ubiquitin-protein ligase SMURF1 (SMURF1), partial

In Stock
Code CSB-EP875720HU1a0
Abbreviation Recombinant Human SMURF1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
198-374aa
Target Protein Sequence
VESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that acts as a negative regulator of BMP signaling pathway. Mediates ubiquitination and degradation of SMAD1 and SMAD5, 2 receptor-regulated SMADs specific for the BMP pathway. Promotes ubiquitination and subsequent proteasomal degradation of TRAF family members and RHOA. Promotes ubiquitination and subsequent proteasomal degradation of MAVS. Plays a role in dendrite formation by melanocytes.
Gene References into Functions
  1. Nedd8 binding to Smurf plays important roles in the regulation of cell migration and the BMP and TGFbeta signaling pathways. PMID: 28169289
  2. Expression of Smurf1 was increased with WHO grade and was consistent with poor prognosis of gliomas. PMID: 28321604
  3. Smurf1 interacts with and targets Securin, an inhibitor of sister-chromatid separation, for poly-ubiquitination and proteasomal degradation. PMID: 28658604
  4. Smurf1 overexpression decreases USP25 protein turnover, and the E3 ligase enzymatic activity of Smurf1 is required for USP25 degradation. PMID: 29518389
  5. SMURF1 can be potentially used as a clinical biomarker and target for novel treatment of human GC. PMID: 28731194
  6. Uev1A appears to be involved in the BMP signaling pathway in which it collaborates with a ubiquitin E3 ligase Smurf1 to promote Smad1 degradation in a Ubc13-independent manner. PMID: 28771228
  7. High smurf1 expression is associated with neoplasms. PMID: 27036023
  8. activation of AMPK upregulated Smad6 and Smurf1 and thereby enhanced their interactions, resulting in its proteosome-dependent degradation of ALK2. PMID: 28847510
  9. we propose that the PKA-Smurf1-PIPKIgamma pathway has an important role in pulmonary tumorigenesis and imposes substantial clinical impact on development of novel diagnostic markers and therapeutic targets for lung cancer treatment. PMID: 28581524
  10. SMURF1 is increased in patients with pulmonary arterial hypertension PMID: 27214554
  11. Data suggest that SMURF1 is required for S phase progression; SMURF1 promotes ubiquitination-dependent degradation of WEE1; these functions of SMURF1 appear to be linked and may be important in cell proliferation and tumorigenesis. (SMURF1 = SMAD specific E3 ubiquitin protein ligase 1; WEE1 = wee 1 homolog [S pombe] protein) PMID: 28294307
  12. Taken together, our study for the first time clarified that the E3 ligase Smurf1 regulates USP5 protein stability and USP5-mediated TNF-alpha production through the ubiquitin proteasome pathway. PMID: 27133717
  13. results reveal the regulatory circuit between RUNX2 and SMURF1 controls RUNX2 expression and regulates odntoblastic differentiation in hDPSCs. PMID: 25260729
  14. EGF/Smurf1 inhibits Wnt/beta-catenin-induced osteogenic differentiation and that Smurf1 downregulates Wnt/b-catenin signaling by enhancing proteasomal degradation of beta-catenin. PMID: 26015066
  15. a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1. PMID: 26004137
  16. SND1 promoted expression of the E3 ubiquitin ligase Smurf1, leading to RhoA ubiquitination and degradation. PMID: 25596283
  17. NF-kappaB bind to the -411 to -420 region of the SMURF1 promoter and plays an essential role in the expression of SMURF1. PMID: 26252093
  18. Smurf1 determines cell apoptosis rates downstream of DNA damage-induced ATR/Chk1 signalling by promoting degradation of RhoB. PMID: 25249323
  19. The role of SMURF1 and inhibition of BMP signaling in maintaining a CSC-like population was confirmed by the loss of a CD44(high) expressing. PMID: 25471937
  20. Results suggest that elevated transcription and expression levels of ubiquitin ligase E3s WWP1, Smurf1 and Smurf2 genes may be the mechanisms of occurrence, development and metastasis of prostate cancer. PMID: 25051198
  21. Fbxo3 promotes the proteasomal degradation of Smurf1. Fbxo3 promotes the poly-ubiquitination of Smurf1. PMID: 25721664
  22. TRIB2 associated-ubiquitin E3 ligases beta-transducin repeat-containing E3 ubiquitin protein ligase (beta-TrCP), COP1 and Smad ubiquitination regulatory factor 1 (Smurf1) reduced TCF4/beta-Catenin expression, and these effects could be enhanced by TRIB2. PMID: 25311538
  23. association of cortactin with Pfn-1 is regulated by c-Abl-mediated cortactin phosphorylation PMID: 24700460
  24. Smurf1 is localized within the Hirano bodies of Alzheimer's disease brains. PMID: 24238996
  25. CKIP-1 controlled Smurf1 expression in colon cancer PMID: 23995790
  26. Inhibiting Smurf1 mediated ubiquitination of Smad1/5. PMID: 24828823
  27. Results suggest that EGF-induced SMURF1 plays a role in breast cancer cell migration and invasion through the downregulation of RhoA. PMID: 24241683
  28. impaired phosphorylation and ubiquitination by p70S6K and Smurf1 increase the protein stability of TRIB2 in liver cancer PMID: 24089522
  29. Data indicate that Smad ubiquitin regulatory factor Smurf1 regulates cell migration through ubiquitination of tumor necrosis factor receptor-associated factor 4 (TRAF4). PMID: 23760265
  30. Resistance exercise resulted in a significant downregulation of MSTN and FBXO32 mRNA expression and a significant upregulation in FSTL3 and SMURF1 mRNA expression, and carbohydrate and protein feeding have little influence on the these markers expression. PMID: 22476926
  31. Smurf1 turnover is mediated by Ckip-1 and Rpt6. PMID: 23032291
  32. The expression of SMURF1 is enhanced in hepatocellular carcinoma, which may have played a role in the disease through affecting apoptosis and proliferation of hepatic cancer cells. PMID: 23042388
  33. USP9X is an important regulatory protein of SMURF1. PMID: 23184937
  34. Ndfip1 negatively regulates RIG-I-dependent immune signaling by enhancing E3 ligase Smurf1-mediated MAVS degradation. PMID: 23087404
  35. A Cdh1-APC/Smurf1/RhoA pathway that mediates axonal growth suppression in the developing mammalian brain. PMID: 22949615
  36. Smurf1 is a negative feedback regulator for IFN-gamma signaling by targeting STAT1 for ubiquitination and proteasomal degradation. PMID: 22474288
  37. Inflammatory cytokines led to direct activation of Smurf1 and downregulation of miR-17, thereby increasing degradation of Smurf1-mediated osteoblast-specific factors. PMID: 21898695
  38. studies uncover a cell-cycle-independent function of Cdh1, establishing Cdh1 as an upstream component that governs Smurf1 activity PMID: 22152476
  39. SMURF1 is an amplified oncogene driving multiple tumorigenic phenotypes in pancreatic cancer PMID: 21887346
  40. Data report that the C2 domain of Smurf1 is necessary and sufficient for binding RhoA, and therefore is crucial for targeting RhoA for ubiquitination. PMID: 21708152
  41. ER stress induces Smurf1 degradation and WFS1 up-regulation PMID: 21454619
  42. the Smurf1 C2 domain has a role in substrate selection and cellular localization PMID: 21402695
  43. This study provided the first evidence that Smurf1 functions as an E3 ligase to promote the ubiquitination and proteasomal degradation of KLF2. PMID: 21382345
  44. These results suggest a new role of Smurf1 in inflammation and immunity through controlling the degradation of TRAFs. PMID: 19937093
  45. plasma membrane localization of Smad7 by Smurf1 requires the C2 domain of Smurf1 and is essential for the inhibitory effect of Smad7 in the transforming growth factor-beta signaling pathway PMID: 12151385
  46. CRM1-dependent nuclear export of Smurf1 is essential for the negative regulation of TGF-beta signaling by Smad7. PMID: 12519765
  47. Smurf1 links the Cdc42/Rac1-PAR6 polarity complex to degradation of RhoA in lamellipodia and filopodia to prevent RhoA signaling during dynamic membrane movements PMID: 14657501
  48. Smad7 and Smurf1 have roles in regulation of TGF-beta signaling in scleroderma fibroblasts PMID: 14722617
  49. rhoA GTP-Binding Protein is targeted for ubiquitination and degradation via Smurf1 PMID: 15710384
  50. Smad6 interacts with Runx2 and mediates Smad ubiquitin regulatory factor 1-induced Runx2 degradation PMID: 16299379

Show More

Hide All

Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Tissue Specificity
Expressed in melanocytes.
Database Links

HGNC: 16807

OMIM: 605568

KEGG: hsa:57154

STRING: 9606.ENSP00000354621

UniGene: Hs.189329

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*