Recombinant Human Egl nine homolog 2 (EGLN2), Partial

In Stock
Code CSB-EP007482HUa2
Abbreviation Recombinant Human EGLN2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Egl nine homolog 2;Estrogen-induced tag 6;EIT-6;HPH-3;Hypoxia-inducible factor prolyl hydroxylase 1;HIF-PH1;HIF-prolyl hydroxylase 1;HPH-1;Prolyl hydroxylase domain-containing protein 1;PHD1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
283-407aa
Target Protein Sequence
MVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Prolyl hydroxylase that mediates hydroxylation of proline residues in target proteins, such as ATF4, IKBKB, CEP192 and HIF1A. Target proteins are preferentially recognized via a LXXLAP motif. Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF2A. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Under hypoxic conditions, the hydroxylation reaction is attenuated allowing HIFs to escape degradation resulting in their translocation to the nucleus, heterodimerization with HIF1B, and increased expression of hypoxy-inducible genes. EGLN2 is involved in regulating hypoxia tolerance and apoptosis in cardiac and skeletal muscle. Also regulates susceptibility to normoxic oxidative neuronal death. Links oxygen sensing to cell cycle and primary cilia formation by hydroxylating the critical centrosome component CEP192 which promotes its ubiquitination and subsequent proteasomal degradation. Hydroxylates IKBKB, mediating NF-kappa-B activation in hypoxic conditions. Also mediates hydroxylation of ATF4, leading to decreased protein stability of ATF4.
Gene References into Functions
  1. 4-bp Insertion/deletion Polymorphism within the Promoter of EGLN2 is associated with breast cancer. PMID: 29693343
  2. Our study provided initial evidence that the insertion/deletion polymorphism rs10680577 may play a functional role in the development of CRC in the Chinese population PMID: 28218358
  3. In advanced-stage Hodgkin's Lymphoma patients strong cytoplasmic PHD1 expression in Reed-Sternberg cells was associated with poor relapse-free survival among patients treated with involved-field radiotherapy and advanced-stage patients treated with doxorubicin, bleomycin, vinblastine and darcabazine and involved-field radiotherapy. PMID: 29277791
  4. This study provides new information relating to the possible mechanism of therapeutic action of hydroxylase inhibitors that has been reported in pre-clinical models of intestinal and hepatic disease. PMID: 27130823
  5. PHD1 is phosphorylated by CDK2, CDK4 and CDK6 at Serine 130. PMID: 26644182
  6. siRNA-mediated knockdown of PHD1 inhibited glucose-stimulated insulin secretion in pancreatic Beta cells. PMID: 26997627
  7. EglN2 associates with the NRF1-PGC1alpha complex and controls mitochondrial function in breast cancer PMID: 26492917
  8. rs3733829 in the EGLN2 gene is significantly associated with the risk of COPD in Chinese populations of Hainan province. PMID: 25609945
  9. study conducted to investigate the association between gastric cancer (GC) susceptibility with a 4-bp insertion/deletion polymorphism (rs10680577) in the proximal promoter of EGLN2; findings showed that the heterozygote and the homozygote 4-bp del/del confer a significantly increased risk of GC PMID: 24517638
  10. Data indicate that the prolyl hydrolase 1 (PHD1) rs10680577 polymorphism is associated with the risk of non-small cell lung cancer in a Chinese population. PMID: 24894671
  11. PHD-1 played an important role in hypoxic response pathway of trophoblast through modulating the level of HIF-2alpha. PMID: 24644426
  12. PHD1 could induce cell cycle arrest in lung cancer cells, resulting in the suppression of cell proliferation. PMID: 24935227
  13. Results show that variants in two adjacent genes, EGLN2 and CYP2A6, influence smoking behavior related to disease risk. PMID: 24045616
  14. Onconeuronal antigen Cdr2 correlates with HIF prolyl-4-hydroxylase PHD1 and worse prognosis in renal cell carcinoma. PMID: 23531419
  15. Findings provided strong evidence for the hypothesis that rs10680577 contributes to hepatocarcinogenesis, possibly by affecting RERT-lncRNA structure and subsequently EGLN2 expression. PMID: 23026137
  16. miR-205 serves a protective role against both oxidative and endoplasmic reticulum stresses via the suppression of EGLN2 and subsequent decrease in intracellular reactive oxygen species. PMID: 22859986
  17. Principal component analysis of the covariance matrix of free AIRE-PHD1 highlights the presence of a "flapping" movement, which is blocked in an open conformation upon binding to H3K4me0. PMID: 23077531
  18. PHD1 expression correlated with high proliferation, and these tumors were mainly estrogen receptor-negative. PMID: 21877141
  19. Coexistence of PHD1 stabilized ATF4, as opposed to the destabilization of ATF4 by PHD3. PMID: 21951999
  20. human prolyl hydroxylase might play an important role in determining the physiology and structure of the corpora lutea during the menstrual cycle and early pregnancy PMID: 20840881
  21. role for PHD1 as a positive regulator of intestinal epithelial cell apoptosis in the inflamed colon PMID: 20600011
  22. Prolyl hydroxylase-dependent (but hypoxia inducible factor HIF-1alpha and -2alpha-independent) activation of hypoxia-induced monocyte-endothelial adhesion assigns a new function to monocytic ICAM-1 under acute hypoxic conditions. PMID: 20574001
  23. identified a human homolog of Caenorhabditis elegans Egl9 as a HIF prolyl hydroxylase PMID: 12351678
  24. effect of WT or mutated VHL on PHD 1, 2, and 3 PMID: 15156561
  25. defines the existence of two species of PHD1 and provide evidence that they are generated by alternative translational initiation PMID: 16509823
  26. Understanding the mechanisms by which nickel can inhibit HIF-PHD's and stabilize HIF-1alpha may be important in the treatment of cancer and ischemic diseases. PMID: 16649251
  27. Multiple mitochondrial products, including tricarboxylic acid intermediates and reactive oxygen species, can coordinate PHD activity, HIF stabilization, and cellular responses to O(2) depletion. PMID: 17101781
  28. hypoxia releases repression of NFkappaB activity through decreased prolyl hydroxylase-dependent hydroxylation of IKKbeta PMID: 17114296
  29. Results describe the expression, purification and characterization of the human prolyl hydroxylase PHD1 in Escherichia coli. PMID: 18710826
  30. The identification of EGLN2 as a significantly deregulated gene that maps within the paired chromosome region directly implicates defects in the oxygen-sensing network to the biology of renal oncocytoma. PMID: 18773095
  31. Overexpression of the oxygen sensor PHD-1 is associated with tumor aggressiveness in pancreatic endocrine tumors. PMID: 18927305
  32. Authors identify an interaction between melanoma antigen-11 (MAGE-11) cancer-testis antigen and the major HIF-alpha hydroxylating enzyme PHD2. PMID: 19147576
  33. Prolyl hydroxylase inhibitor reduced mitochondrial cytochrome c release, nuclear translocation of apoptosis inducing factor (AIF), and promoted Akt phosphorylation PMID: 19229863

Show More

Hide All

Subcellular Location
Nucleus.
Tissue Specificity
Expressed in adult and fetal heart, brain, liver, lung, skeletal muscle, and kidney. Also expressed in testis and placenta. Highest levels in adult brain, placenta, lung, kidney, and testis. Expressed in hormone responsive tissues, including normal and ca
Database Links

HGNC: 14660

OMIM: 606424

KEGG: hsa:112398

STRING: 9606.ENSP00000307080

UniGene: Hs.515417

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*