Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial

In Stock
Code CSB-EP850258HU
Abbreviation Recombinant Human ESAM protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Adhesion
Alternative Names
2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein ; LP4791 protein ; W117m
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-248aa
Target Protein Sequence
QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Constructing a plasmid that codes for the Human ESAM protein (30-248aa) is the initial step to yield the recombinant Human ESAM protein. The plasmid is then transferred into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. A N-terminal 6xHis-SUMO tag is fused to the protein. The affinity purification is used to purify the protein, and SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. The protein possesses a purity exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Can mediate aggregation most likely through a homophilic molecular interaction.
Gene References into Functions
  1. sESAM levels associate with myocardial infarction, heart failure, and death after adjustment for demographic and clinical risk factors, but not after adjustment for kidney function. PMID: 26523992
  2. ESAM is a novel human hematopoietic stem cell marker associated with a subset of human leukemias PMID: 26774386
  3. Serum ESAM is higher in type 2 diabetes mellitus than in controls and parallels oxidative stress. PMID: 24456423
  4. sESAM is associated with albuminuria and reduced kidney function in patients with coronary artery disease in both cross-sectional and longitudinal analyses. PMID: 24177327
  5. ESAM regulates tumor metastasis through endothelial cell migration and tube formation in metastatic nodules. PMID: 20153339
  6. sESAM is a predictive biomarker and potential mediator of atherosclerosis. PMID: 19759376

Show More

Hide All

Subcellular Location
Cell junction, adherens junction. Cell junction, tight junction. Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Highly expressed in endothelial cells.
Database Links

HGNC: 17474

OMIM: 614281

KEGG: hsa:90952

STRING: 9606.ENSP00000278927

UniGene: Hs.173840

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*