Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ESAM

Uniprot No.

Q96AP7

Research Area

Cell Adhesion

Alternative Names

2310008D05Rik; Endothelial cell adhesion molecule; Endothelial cell selective adhesion molecule; Endothelial cell-selective adhesion molecule; Esam; ESAM_HUMAN; HUEL (C4orf1) interacting protein ; LP4791 protein ; W117m

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

30-248aa

Target Protein Sequence

QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

39.8kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Constructing a plasmid that codes for the Human ESAM protein (30-248aa) is the initial step to yield the recombinant Human ESAM protein. The plasmid is then transferred into e.coli cells. Positive e.coli cells are selected and cultured for the protein expression. A N-terminal 6xHis-SUMO tag is fused to the protein. The affinity purification is used to purify the protein, and SDS-PAGE analysis is carried out to verify the presence and assess the purity of the protein. The protein possesses a purity exceeding 90%.

Target Background

Function

Can mediate aggregation most likely through a homophilic molecular interaction.

Gene References into Functions

sESAM levels associate with myocardial infarction, heart failure, and death after adjustment for demographic and clinical risk factors, but not after adjustment for kidney function. PMID: 26523992
ESAM is a novel human hematopoietic stem cell marker associated with a subset of human leukemias PMID: 26774386
Serum ESAM is higher in type 2 diabetes mellitus than in controls and parallels oxidative stress. PMID: 24456423
sESAM is associated with albuminuria and reduced kidney function in patients with coronary artery disease in both cross-sectional and longitudinal analyses. PMID: 24177327
ESAM regulates tumor metastasis through endothelial cell migration and tube formation in metastatic nodules. PMID: 20153339
sESAM is a predictive biomarker and potential mediator of atherosclerosis. PMID: 19759376

Hide All

Subcellular Location

Cell junction, adherens junction. Cell junction, tight junction. Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

Highly expressed in endothelial cells.

Database Links

HGNC: 17474

OMIM: 614281

KEGG: hsa:90952

STRING: 9606.ENSP00000278927

UniGene: Hs.173840

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP850258HU
Abbreviation	Recombinant Human ESAM protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage