Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

GABARAPL1

Uniprot No.

Q9H0R8

Research Area

Neuroscience

Alternative Names

APG8 like; APG8L; ATG8; ATG8B; ATG8L; Early estrogen regulated protein; Early estrogen-regulated protein; GABA; GABA(A) receptor associated protein like 1; GABA(A) receptor-associated protein-like 1; GABARAPL1 a; GABARAPL1; Gamma aminobutyric acid receptor associated protein like 1; Gamma-aminobutyric acid receptor-associated protein-like 1; GBRL1_HUMAN; GEC 1; GEC-1; GEC1; Glandular epithelial cell protein 1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-117aa

Target Protein Sequence

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.9kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Synthesizing the recombinant Human GABARAPL1 protein generally involves integrating the DNA fragment that encodes the Human GABARAPL1 protein (1-117aa) into a plasmid, introducing the recombinant plasmid into e.coli cells, followed by the selection and culturing of positive e.coli cells, induction of protein expression, and subsequent cell lysis. A N-terminal GST tag is fused to the protein. The protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. The protein's purity surpasses 90%.

Target Background

Function

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.

Gene References into Functions

these results indicate that miR-195 regulates cell proliferation, migration, angiogenesis and autophagy of hEPCs by targeting GABARAPL1 PMID: 27623937
Our data demonstrated that a specific decrease of GABARAPL1 expression in breast cancers was associated with both DNA methylation and histone deacetylation and that CREB-1 recruitment on GABARAPL1 PMID: 26474850
Androgen deprivation downregulates Gabarapl1 in an AR dependent manner, resulting in the increase of autophagy flux PMID: 26050226
GABARAPL1 plays an important role in cell proliferation, invasion, and autophagic flux, as well as in mitochondrial homeostasis and cellular metabolic programs in a breast cancer cell line. PMID: 24879149
Kaplan-Meier survival analysis showed a significant association between low GABARAPL1 expression and poor prognosis of HCC patients. PMID: 24647565
Data demonstrate that HSP90 interacts and protects GABARAPL1 from its degradation by the proteasome. PMID: 22120110
analysis of specific functions of GABARAPL1 [review] PMID: 21597319
Atg8 interacting motif (AIM) in Stbd1 is necessary for GABARAPL1 binding. PMID: 21893048
Results indicate that the presence of a tryptophan residue in the LIR motif increases the binding affinity of GABARAPL-1/NBR1-LIR complex. PMID: 21620860
Gabarapl1 mRNA expression in breast tumours is a good indicator of the risk of recurrence, specifically in lymph nodes positive patients. PMID: 20197771
GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor PMID: 16431922
GEC1-kappa opioid receptor binding involves hydrophobic interactions: GEC1 has chaperone-like effect. PMID: 19001416
Caspase cleavage of Atg4D stimulates GABARAP-L1 processing and triggers mitochondrial targeting and apoptosis. PMID: 19549685

Hide All

Subcellular Location

Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle membrane; Lipid-anchor. Cytoplasm, cytoskeleton. Endoplasmic reticulum. Golgi apparatus.

Protein Families

ATG8 family

Tissue Specificity

Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motone

Database Links

HGNC: 4068

OMIM: 607420

KEGG: hsa:23710

STRING: 9606.ENSP00000266458

UniGene: Hs.524250

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP861986HU
Abbreviation	Recombinant Human GABARAPL1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage