Your Good Partner in Biology Research
Your Good Partner in Biology Research
| Code | CSB-EP861986HU |
| Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | GABARAPL1 |
| Uniprot No. | Q9H0R8 |
| Research Area | Neuroscience |
| Alternative Names | APG8 like; APG8L; ATG8; ATG8B; ATG8L; Early estrogen regulated protein; Early estrogen-regulated protein; GABA; GABA(A) receptor associated protein like 1; GABA(A) receptor-associated protein-like 1; GABARAPL1 a; GABARAPL1; Gamma aminobutyric acid receptor associated protein like 1; Gamma-aminobutyric acid receptor-associated protein-like 1; GBRL1_HUMAN; GEC 1; GEC-1; GEC1; Glandular epithelial cell protein 1 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 1-117aa |
| Target Protein Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 40.9kDa |
| Protein Length | Full Length |
| Tag Info |
N-terminal GST-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover.
|
| Gene References into Functions |
|
| Subcellular Location | Cytoplasmic vesicle, autophagosome. Cytoplasmic vesicle membrane; Lipid-anchor. Cytoplasm, cytoskeleton. Endoplasmic reticulum. Golgi apparatus. |
| Protein Families | ATG8 family |
| Tissue Specificity | Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motone |
| Database Links |
HGNC: 4068 OMIM: 607420 KEGG: hsa:23710 STRING: 9606.ENSP00000266458 UniGene: Hs.524250 |
