Code | CSB-RP150994h |
Abbreviation | Recombinant Human HLA-C protein, partial |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Recombinant Human HLA-C protein is a prokaryotic system E.coli expressed Partial protein. To make this HLA-C recombinant protein, the HLA-C gene is synthesized and cloned into the E.coli system expression vector, and then it was transformed into protein-expressing host E Coli for expression, the other steps are testing for the identification of recombinant protein, large scale production and target protein Isolation and purification. The purity of the final HLA-C protein is 90%+ as determined by SDS-PAGE.
HLA-C belongs to the HLA class I heavy chain receptors in human. This protein is a heterodimer consisting of a HLA-C mature gene product (a heavy chain) and a light chain (β2-microglobulin). The heavy chain is anchored in the membrane. MHC Class I molecules, like HLA-C present small peptides to the immune system, allowing cytotoxic T lymphocytes to bind to mature HLA cell surface proteins via the antigen-binding groove. Class I genes mainly bind antigens to Presented to CD8+ T cells, class II genes primarily present antigens to CD4+ T cells.There are currently no reviews for this product.
We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu C.
Could you please provide some idea about it?
CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI