Name: Recombinant Human HLA-C protein (HLA-C), partial
Brand: CUSABIO
SKU: CSB-RP150994h

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot No.

O78179

Research Area

Immunology

Source

E.coli

Expression Region

25-308aa

Target Protein Sequence

CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.7kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Human HLA-C protein is a prokaryotic system E.coli expressed Partial protein. To make this HLA-C recombinant protein, the HLA-C gene is synthesized and cloned into the E.coli system expression vector, and then it was transformed into protein-expressing host E Coli for expression, the other steps are testing for the identification of recombinant protein, large scale production and target protein Isolation and purification. The purity of the final HLA-C protein is 90%+ as determined by SDS-PAGE.

HLA-C belongs to the HLA class I heavy chain receptors in human. This protein is a heterodimer consisting of a HLA-C mature gene product (a heavy chain) and a light chain (β2-microglobulin). The heavy chain is anchored in the membrane. MHC Class I molecules, like HLA-C present small peptides to the immune system, allowing cytotoxic T lymphocytes to bind to mature HLA cell surface proteins via the antigen-binding groove. Class I genes mainly bind antigens to Presented to CD8+ T cells, class II genes primarily present antigens to CD4+ T cells.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu C.
Could you please provide some idea about it?

As to your request for the antigen of C, please check detailed information as follows:
Recombinant Human HLA-C protein(HLA-C),partial
CSB-RP150994h
Expression Region:25-308aa; Partial.
Tag information:N-terminal 6xHis-tagged
Sequence:

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address