Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-RP150994h |
| Product Type | Recombinant Protein |
| Size |
US$1726Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | O78179 |
| Lead Time | 3-7 business days |
| Relevance | Involved in the presentation of foreign antigens to the immune syst.SAAS annotation |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI |
| Research Area | Immunology |
| Source | E.coli |
| Expression Region | 25-308aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 36.7kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu C.
Could you please provide some idea about it?
CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI
Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA15099D0Rb | HLA-C Antibody, Biotin conjugated | Human | ELISA, IHC |
| CSB-PA15099B0Rb | HLA-C Antibody, HRP conjugated | Human | ELISA |
| CSB-PA15099C0Rb | HLA-C Antibody, FITC conjugated | Human | ELISA |
| CSB-PA15099A0Rb | HLA-C Antibody | Human | ELISA, WB, IHC, IF |
Recombinant Salmonella typhimurium D-galactose-binding periplasmic protein(mglB)
Express system: Yeast
Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Recombinant Human RNA-binding protein 14(RBM14)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Glutathione S-transferase kappa 1(GSTK1) (Active)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rabbit Serum amyloid A-1 protein(SAA1)
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Human LIM domain transcription factor LMO4(LMO4)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Pterin-4-alpha-carbinolamine dehydRatase(PCBD1)
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
