Recombinant Human Heme oxygenase 1 (HMOX1), partial

Code CSB-EP010583HU1m10
Abbreviation Recombinant Human HMOX1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-237aa
Target Protein Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-mCherry-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Gene References into Functions
  1. Study found that plasma HO-1 levels were low in patients with peripheral artery disease, in contrast to high levels in patients with coronary artery disease. PMID: 30159103
  2. HO-1 is over-expressed in sera of psoriasis patients and is correlated with psoriasis extent and severity. PMID: 30105448
  3. Pregnant women who subsequently develop severe preeclampsia show higher expression of HO-1. PMID: 30363976
  4. Our findings identify survivin as a target of HO-1 and a mediator of adipocyte-induced survival in the metastatic niche. PMID: 29311669
  5. the role of HO-1 in nervous system pointing out different molecular mechanisms possibly responsible for HO-1 up-regulation in nervous system homeostasis and neurodegeneration. PMID: 30071692
  6. HO-1 may serve as a prognostic marker and a new target to modulate chemotherapeutic effects in patients with small-intestinal adenocarcinomas PMID: 29537718
  7. The T allele of heme oxygenase 1 gene SNP polymorphism (rs2071746) is a risk factor for esophageal varices development in cirrhotics. PMID: 29877949
  8. Data show that the ferroptotic process induced by heme oxygenase-1 (HO-1). overexpression indicated that HO-1 is a key mediator of BAY 11-7085 (BAY)-induced ferroptosis that operates through cellular redox regulation and iron accumulation. PMID: 29274359
  9. Heme oxygenase activity increases after exercise in healthy volunteers. PMID: 29343136
  10. Results show that HO-1 is overexpressed in pancreatic cancer (PC) cells, induces cell proliferation and SHH signaling pathway activation as well as resistance to anticancer therapy. PMID: 29620188
  11. the expression of hsa_circRNA0054633 has a protective effect against high glucoseinduced endothelial cell dysfunction by targeting ROBO1 and HO1. PMID: 29693114
  12. the 14 kDa HO-1 is shown to promote cell proliferation and an increase in relative telomere lengths in vivo and in vitro. PMID: 29660345
  13. HO-1 plays a key role in protecting tumor cells from apoptosis, in a process that involves Smad7 and HDAC4/5 in apoptosis of B-ALL cells PMID: 29886060
  14. HO-1 might be a potential marker for prediction of ovarian cancer prognosis and a target for ovarian cancer treatment PMID: 28808929
  15. HO-1 was an important cellular factor against Dengue virus replication. PMID: 27553177
  16. our results demonstrate that Pc-induced expression of HO-1 is mediated by the PKCA-Nrf-2/HO-1 pathway, and inhibits UVB-induced apoptotic cell death in primary skin cells. PMID: 29470442
  17. HO-1 regulates macrophage activation via the SIRT1-p53 signaling network and regulates hepatocellular death in liver ischemia-reperfusion injury. PMID: 28842295
  18. In light of a pivotal role of NRF2 and BACH1 in response to oxidative stress and regulation of HO-1, we examined if smoke-induced HO-1 expression is modulated through the NRF2/BACH1 axis. We demonstrated that smoke causes significant nuclear translocation of NRF2, but only a slight decrease in nuclear BACH1. PMID: 29125538
  19. downregulation of HO-1 gene expression in patients with inflammatory bowel disease. PMID: 28770550
  20. This study demonstrated that HO-1 plays a vital role in the development of gastric cancer and may serve as a therapeutic target of this type of cancer PMID: 29048628
  21. Overexpression of HO-1 inhibited the increase in nucleus pulposus cell apoptosis after IL-1beta treatment and simultaneously inhibited the expression of p-P65. PMID: 29617687
  22. We also found a subset of prostate cancer patient-derived xenografts and prostate cancer patient samples with mild HO-1 and low Gal-1 expression levels. These results highlight a novel function of a human-used drug as a means of boosting the antitumor response PMID: 28512172
  23. Our data suggest that HO-1 exerts its inhibitory effect on Th17 cell differentiation by directly associating and blocking STAT3 phosphorylation. We speculate that hemin may be a potential therapeutic candidate for the treatment of other types of immune and pulmonary inflammatory-related diseases. PMID: 28580587
  24. recipient promoter region (GT)n genotype may contribute to cardiac allograft vasculopathy development PMID: 28186648
  25. study implies that DJ-1 may protect endothelial progenitor cells against Ang II-induced dysfunction by activating the PPARgamma/HO-1. PMID: 28600848
  26. These results revealed that hemin treatment increased HMOX1 expression and inhibited TGFbetainduced epithelial-mesenchymal transition in MCF7 cells. PMID: 28627599
  27. There was no association between HMOX1 gene promoter polymorphism and manifestation of Fabry Disease. PMID: 28951772
  28. Most published Newborn studies demonstrated no effect of HO-1 promoter polymorphisms on the Neonatal Hyperbilirubinemia. PMID: 28206992
  29. Genetic mutations within MAPK1 (rs6928, rs9340, rs11913721), HIF-1 (rs1087314, rs2057482), and HO-1 (rs2071746) could alter susceptibility to perimenopausal coronary artery disease in Chinese population. PMID: 28444966
  30. The overexpression of HO1 alleviated oxidative damage through inhibition of the PI3K/AKT signaling pathway and downregulation of the expression of cMyc. PMID: 28713890
  31. Study shows that heme degradation by HO-1 is required for aggresome-like induced structures (ALIS) formation, and that the free iron released on heme degradation is necessary and sufficient to induce ALIS. PMID: 27821769
  32. co-expression patterns of NGF and heme oxygenase-1 might be used as prognostic indicators for gastric carcinoma patients PMID: 28679437
  33. These results suggest that HO-1 is involved in oxygen-glucose deprivation-evoked upregulation of apical junctional complex proteins, which is partly mediated by MMP9 pathway. PMID: 29425821
  34. HMOX-1, an anti-oxidase, is a bona fide transcriptional target gene of HSF4 in HLECs (human lens epithelial cells). HSF4 directly binds to the HSE element in HMOX-1 promoter to mediate its mRNA transcription and protein accumulation. PMID: 29454088
  35. The regulated HO-1 expression of Bone marrow stromal cells provides a new putative target for chronic myeloid leukemia therapy. PMID: 28445830
  36. Dihydromyricetin (DMY) protects HUVECs from ox-LDL-induced oxidative injury by activating Akt and ERK1/2, which subsequently activates Nrf2/HO-1 signaling, thereby up-regulating antioxidant enzymes and anti-apoptotic proteins. PMID: 28612103
  37. review of non-canonical functions of the HO isoforms: protein-protein interaction, intracellular compartmentalization, and extracellular secretion [review] PMID: 27626166
  38. The interaction between ALAD rs1800435 and the HMOX1 rs2071746, HMOX1 rs2071747 was not associated with essential tremor. PMID: 28276576
  39. Docosahexaenoic acid (DHA) activates Nrf2, possibly through modification of critical Keap1 cysteine 288 residue and PKCdelta-mediated phosphorylation of Nrf2, leading to upregulation of HO-1 and NQO1 expression. PMID: 28604588
  40. These results suggest that RYR extract serves as alternative and complementary medicine in the treatment of these diseases, by inducing HO-1, thereby decreasing the vascular complications of diabetes PMID: 28555162
  41. These results indicate that TNFRI-Fc and hHO-1 overexpression may apparently induce free iron in the liver and exert oxidative stress by enhancing reactive oxygen species production and block normal postneonatal liver metabolism. PMID: 28503569
  42. Mice overexpressing human HO-1 specifically in astrocytes are protected from collagenase-induced intracerebral hemorrhage, as examined by striatal cell viability, neurological deficits and mortality. PMID: 28323022
  43. HMOX1 negatively regulates MMP-9 expression in chronic lymphocytic leukemia cells in response to arsenic trioxide, through modulation of the p38 MAPK/AP-1 signaling pathway. PMID: 27829220
  44. Review/Meta-analysis: both the HO-1(GT)n repeat length polymorphism and the T(-413)A SNP are associated with decreased risk of coronary heart disease. The (GT)n repeat length polymorphism was associated with coronary restenosis following PCI. PMID: 27825138
  45. These data suggest that heme oxygenase-1 is induced during acute HIV-1 infection, likely mediating anti-inflammatory effects and driving expansion of heme oxygenase-1-specific CD8 regulatory T cells capable of suppressing HIV-1-specific immune responses in vitro. PMID: 28060008
  46. Among myelodysplastic syndromes patients only, CD163 + macrophage density and HO1 and H-ferritin expression by CD163 + macrophages increased in tandem with marrow iron. High HO1 was significantly associated with shorter overall survival. PMID: 26758041
  47. elevated HMOX1 expression is associated with stemness in Glioblastoma multiforme and can be modulated through TGFbeta. PMID: 27354342
  48. Fetal GTn Repeat in the Heme Oxygenase 1 Promoter Is Associated With Severe and Early-Onset Preeclampsia. PMID: 29203625
  49. CAL suppresses the expression of pro-inflammatory cytokines via p62/Nrf2-linked HO-1 induction in RASFs. PMID: 27678042
  50. Findings indicate the importance of nuclear heme oxygenase-1 (HO-1) post-translational modification in the induction of cancer progression. PMID: 28846111

Show More

Hide All

Involvement in disease
Heme oxygenase 1 deficiency (HMOX1D)
Subcellular Location
Microsome. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Heme oxygenase family
Tissue Specificity
Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).
Database Links

HGNC: 5013

OMIM: 141250

KEGG: hsa:3162

STRING: 9606.ENSP00000216117

UniGene: Hs.517581

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*