Recombinant Human Histone deacetylase 2 (HDAC2)

In Stock
Code CSB-EP010238HU
Abbreviation Recombinant Human HDAC2 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Protein deacylase HDAC2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-488aa
Target Protein Sequence
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.3 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
Gene References into Functions
  1. Results found that HDAC2 expression is up-regulated in patients with chronic diabetic foot ulcer and in high glucose induced endothelial progenitor cells. PMID: 30063937
  2. Comparative molecular docking studies of the lead RH01652 with class I HDACs (HDAC1, HDAC2, HDAC3, and HDAC8) shows higher binding affinity towards HDAC2. Thus, lead RH01652 could serve as template to design novel and potent inhibitor of HDAC2. PMID: 29932788
  3. human immortalized telencephalic/mesencephalic microglial cells reveal significant upregulation of HDAC2 in the presence of the potent microglial activator lipopolysaccharide PMID: 29803514
  4. we found that HDAC2 was the direct target of miR-31 by binding to 3'-UTR from the results of luciferase reporter assays, qRT-PCR, and western blotting. HDAC2 played an activation role in tumor growth, whose expression is upregulated and inversely associated with miR-31 levels PMID: 29333444
  5. data indicate that the obesity impacts on H4ac levels and that strenuous exercise leads to an enhanced chronic low-grade inflammation profile in obesity via an imbalance on H4ac/HDAC2. PMID: 29142617
  6. Knockdown of HDAC2 completely mimicked the effects of 1,25(OH)2D3 on PTEN gene expression. PMID: 28737824
  7. Muscle biopsies of chronic obstructive pulmonary disease significantly correlated with HDAC2 decrease compared to controls. PMID: 28526090
  8. With tissue microarrays of hepatocellular carcinoma (HCC) patients, we determined the prognostic values of the core genes in the network and found that RAD21, CDK1, and HDAC2 expression levels were negatively associated with overall survival for HCC patients. PMID: 28434945
  9. Combined treatment with the histone deacetylase inhibitors (HDACi) suberoylanilide hydroxamic acid plus 5-fluorouracil (5-FU) and oxaliplatin (Oxa) reduced the level of HDAC2 expression in HT-29 cells. PMID: 27283986
  10. miR-223 controls the expression of CX3CL1 by targeting HDAC2 in chronic obstructive pulmonary disease patients and mouse models of the disease. PMID: 26864305
  11. Data show that BRCA2 was required for HDAC2/3 association with acetylated BubR1 in nocodazole (Noc)-arrested cells. PMID: 28985013
  12. study defines two classes of HDAC2 targets in human cells, with a dependence of HDAC1 on HDAC2 at one class of targets, and distinguishes unique functions for HDAC2 PMID: 28982113
  13. This study demonstrated that the Expression of HDAC2 Transcript Is Reduced in Dorsolateral Prefrontal Cortex of Patients with Schizophrenia. PMID: 27959513
  14. The findings suggest that miR-455-3p plays a critical role during chondrogenesis by directly targeting HDAC2/8 and promoting histone H3 acetylation. PMID: 27638301
  15. report the interaction between CFTR and HDAC2, and its involvement in the development of Ph+ leukemia PMID: 28235656
  16. USP4 inhibits p53 and NF-kappaB through deubiquitinating and stabilizing HDAC2 PMID: 26411366
  17. HDAC2 controls ciliogenesis independently of Kras, which facilitates Aurora A expression. These studies suggest that HDAC2 is a novel regulator of primary cilium formation in PDAC cells. PMID: 28028031
  18. the current findings implicate the HDAC2/miR-101/AMPK pathway as a critical mediator of AD pathogenesis. These studies also highlight the importance of epigenetics in AD and provide novel therapeutic targets. PMID: 28202389
  19. HDAC2 upregulation is associated with hepatocellular carcinoma. PMID: 27342975
  20. Suggest that HDAC2 can trigger migration and invasion of non-small cell lung carcinoma cells by activating NF-kappaB to up-regulate fibronectin expression. PMID: 27665474
  21. KLF4 acts as a tumor suppressor or oncogene to activate or repress target gene transcription depending on its acetylation status, which is regulated by p21 and CK2 interaction-mediated HDAC2 phosphorylation PMID: 26729194
  22. Decreased HDAC2 expression is associated with cisplatin resistance in ovarian cancer. PMID: 26683361
  23. In cigarette smoke extract-exposed airway epithelial cells and macrophages, HDAC2 is excessively ubiquitinated and degraded in the proteasome attributed to low expression of USP17. PMID: 26617781
  24. The results imply that HDAC2 is involved in the transcriptional regulation of human odontoblasts in vivo. PMID: 22297573
  25. Endothelial-Mesenchymal Transition is initiated by recruitment of aberrantly phosphorylated DNMT1 to the RASAL1 CpG island promoter by HDAC2, causing aberrant promoter methylation and transcriptional suppression. PMID: 26815200
  26. Selective inhibition of HDAC2 in lung tumor cell causes survivin downregulation through activation of p53, which is mediated by downregulation of Mdm2. PMID: 25605253
  27. our study revealed that HDAC2 is overexpressed in colorectal cancer (CRC) cells; its knockdown can increase the sensitivity of CRC cells to doxorubicin via upregulation of ABCB1 PMID: 26846508
  28. Pancreatic adenocarcinoma patients with enhanced HDAC-1 and -6 expression showed significantly longer survival times compared to those with low expression, while a borderline association concerning HDAC-2 expression was noted. PMID: 26502922
  29. Lymphocyte senescence in COPD is associated with loss of HDAC2 in CD28nullCD8+ T and NKT-like cells. PMID: 26498345
  30. HDAC2 may not confer susceptibility to Schizophrenia in Han Chinese. PMID: 26063464
  31. In endothelial dysfunction, HDAC2 levels were reciprocally regulated by ectopic expression of NEDD8 and the de-NEDDylating enzyme SENP8. PMID: 25655932
  32. Aberrant overexpression of HDACs in basal cells of IPF lungs may contribute to the bronchiolisation process in this disease. Similarly, generation and apoptosis resistance of IPF fibroblasts are mediated by enhanced activity of HDAC enzymes. PMID: 26359372
  33. HDAC2 sumoylation is important for NF-kappaB-dependent gene expression and for the resistance of cell against stress PMID: 25704882
  34. HDAC2 inhibition reduces proliferation and induces apoptosis via the caspase-dependent pathway in human glioma cell lines, possibly by activating the p53 signaling pathway. PMID: 25523932
  35. Data indicate that that hstone deacetylase 2 (HDAC2) has a specific role in leukemogenesis. PMID: 25473896
  36. HDAC3 is an essential target to disrupt HIV-1 latency, and inhibition of HDAC2 may also contribute to the effort to purge and eradicate latent HIV-1 infection. PMID: 25136952
  37. BRG1/HDAC2 and beta-catenin constitute a manipulative apparatus at the transcription start site to play opposite but complementary roles in regulating hTERT expression. PMID: 25486475
  38. HDAC2 plays a central role in coupling lysine acetylation to synaptic plasticity and mediates many of the effects of HDAC inhibition in cognition and disease. PMID: 25492968
  39. Data suggest that p15RS (p15INK4b-related sequence) acts as an intrinsic transcriptional repressor for Wnt/beta-catenin-mediated gene transcription through recruiting HDAC2 histone deacetylase. PMID: 25697359
  40. Simultaneous loss of Hdac1 and Hdac2 resulted in loss of hematopoietic stem cells. PMID: 24763403
  41. our data suggested that cPA may have beneficial effects in inflammation-related cardiovascular disease by controlling HDAC2 regulation PMID: 25013374
  42. HDAC2 silencing in HCC cells also strongly inhibited PPARgamma signaling. PMID: 24958469
  43. inhibitory of cell growth by melittin might be led by HDAC2-mediated PTEN upregulation, Akt inactivation, and inhibition of the PI3K/Akt signaling pathways PMID: 24788349
  44. Osteocalcin levels were decreased, an effect induced at the transcriptional level, and were strongly correlated with inhibition of HDAC2. PMID: 24105979
  45. these results indicated that the potential of specific inhibition of HDAC2 by small molecular chemicals may lead to future therapeutic agents in human renal cancer treatment. PMID: 24390319
  46. The proliferation inhibition and cell cycle arrest mediated by downregulated HDAC2 expression may be tightly associated with the decrease of cyclin D1, cyclin E, and cdk2 proteins expression. PMID: 24965412
  47. PELP1 regulates tumor metastasis by controlling the expression and functions of the tumor metastasis suppressors miR-200a and miR-141 PMID: 23975430
  48. HDAC2 is a critical regulator of Arg2 expression and thereby endothelial nitric oxide and endothelial function. PMID: 24833798
  49. Data indicate prominent changes in urothelial cancer cell lines (UCC) were HDAC2 and/or HDAC8 up-regulation. PMID: 22944197
  50. our study has found no association between HDAC2/HDAC3 gene polymorphisms and schizophrenia in the Chinese Han population PMID: 23857786

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Histone deacetylase family, HD type 1 subfamily
Tissue Specificity
Widely expressed; lower levels in brain and lung.
Database Links

HGNC: 4853

OMIM: 605164

KEGG: hsa:3066

STRING: 9606.ENSP00000430432

UniGene: Hs.3352

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*