Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Amine N methyltransferase; Amine N-methyltransferase; Aromatic alkylamine N methyltransferase; Aromatic alkylamine N-methyltransferase; Arylamine N methyltransferase; Arylamine N-methyltransferase; Indolamine N-methyltransferase; Indolethylamine N methyltransferase; Indolethylamine N-methyltransferase; Inmt; INMT_HUMAN; nicotine N methyltransferase ; TEMT; thioester S methyltransferase like; Thioether S methyltransferase
Species
Homo sapiens (Human)
Expression Region
1-263aa
Target Protein Sequence
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant Human INMT protein is a prokaryotic system E.coli expressed Full Length protein. To make this INMT recombinant protein, the INMT gene is synthesized and cloned into the E.coli system expression vector, and then it was transformed into protein-expressing host E Coli for expression, the other steps are testing for the identification of recombinant protein, large scale production and target protein Isolation and purification. The purity of the final INMT protein is 90%+ as determined by SDS-PAGE.
INMT is a protein encoding gene that provides an instruction in making a protein named Indolethylamine N-methyltransferase. The protein encoded by this gene is also known as aromatic alkylamine N-methyltransferase or thioether S-methyltransferase (short name is TEMT). It belongs to a Class 1 transmethylation enzyme that is known for its production of N,N-dimethyltryptamine (DMT), a hallucinogen with affinity for various serotonergic, adrenergic, histaminergic, dopaminergic, and sigma-1 receptors. It has been reported involving in amine metabolic process, methylation and response to toxic substance.
