Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial

In Stock
Code CSB-EP010949HU
Abbreviation Recombinant Human ICAM1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Adhesion
Alternative Names
Antigen identified by monoclonal BB2; BB 2; BB2; CD 54; CD_antigen=CD54; CD54; Cell surface glycoprotein P3.58 ; Human rhinovirus receptor; ICAM 1; ICAM-1; ICAM1; ICAM1_HUMAN; intercellular adhesion molecule 1 (CD54); intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; Intercellular adhesion molecule 1; Major group rhinovirus receptor; MALA 2; MALA2; MyD 10; MyD10; P3.58; Surface antigen of activated B cells; Surface antigen of activated B cells, BB2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
28-480aa
Target Protein Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
76.5kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins.; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins.; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell.
Gene References into Functions
  1. miR-335-5p could target 3'UTR of ICAM-1 and inhibit its expression, preventing invasion and metastasis of thyroid cancer cells. PMID: 30119270
  2. AGEs increase IL-6 and ICAM-1 expression via the RAGE, MAPK and NF-kappaB pathways in HGFs and may exacerbate the progression of the pathogenesis of periodontal diseases. PMID: 29193068
  3. Our meta-analyses provide no evidence of the association of ICAM-1 rs5498 with diabetic retinopathy in type 2 diabetic patients. PMID: 30419874
  4. CORM-2 inhibits P. aeruginosa-induced PGE2/IL-6/ICAM-1 expression and lung inflammatory responses by reducing the Reactive Oxygen Species generation and the inflammatory pathways. PMID: 30007888
  5. Smooth muscle cell-derived bioactive soluble factors may stimulate the ICAM-1 expression of cocultured endothelial cells, possibly leading to leukocyte migration into the subendothelial space. PMID: 29852173
  6. These results together with the authors' previous study, have identified that CNOT1 provides a platform for the recruitment of TTP and CNOT7, and is involved in TTPmediated ICAM1 and IL8 mRNA decay. PMID: 29956766
  7. ICAM-1 expression is not significantly linked to metastatic disease in pancreatic ductal adenocarcinoma. PMID: 29355490
  8. In conclusion, this meta-analysis indicates that ICAM-1 gene rs5498 polymorphism decreases the risk of CAD PMID: 30290609
  9. Data suggest that serum levels of soluble ICAM1 are higher in young adults with reduced physical activity as compared to young adults who participate in optimal physical activity. This study was conducted in Bulgaria with medical and dental students aged 20 +/-2 years. PMID: 29183155
  10. TNF-alpha and IL-10 treatment can affect the expression of ICAM-1 and CD31 in human coronary artery endothelial cells. PMID: 29949812
  11. not a specific screening marker for pulmonary arterial hypertension in systemic sclerosis PMID: 29687288
  12. The ICAM-1 expression level determines the susceptibility of human endothelial cells to simulated microgravity. PMID: 29080356
  13. the combination of IL-6 -572C/G and ICAM-1 K469E polymorphisms have a synergistic effect on the onset of Sudden sensorineural hearing loss. PMID: 29695657
  14. Peripheral blood lymphocyte subsets in patients with lung cancer are different from those in healthy people, and circulating CD44+ and CD54+ lymphocytes seem to be a promising criterion to predict survival in lung cancer patients undergoing chemotherapy PMID: 29148014
  15. serum ICAM-1 levels were associated with type 2 diabetes mellitus with microalbuminuria leading to severity of diabetic kidney disease. PMID: 29310968
  16. Serum CCL2 and sICAM-1 concentrations were significantly decreased in CNS tumors in comparison with the comparative group. Among proteins tested in the serum, a higher area under the ROC curve (AUC) revealed CCL2 compared to sICAM-1 in differentiating subjects with CNS brain tumors from non-tumoral subjects. PMID: 29086194
  17. Patient-derived ATC cells overexpressed ICAM-1 and were largely eliminated by autologous ICAM-1 CAR T cells in vitro and in animal models. Our findings are the first demonstration of CAR T therapy against both a metastatic, thyroid cancer cell line and advanced ATC patient-derived tumors that exhibit dramatic therapeutic efficacy and survival benefit in animal studies PMID: 29025766
  18. Data indicate ICAM-1 as an essential receptor for both acute hemorrhagic conjunctivitis (AHC)-causing and non-AHC strains. PMID: 29284752
  19. The results of cell adhesion and western blotting assays demonstrated that arachidin-1 attenuated tumor necrosis factor (TNF)-alpha-induced monocyte/EC adhesion and intercellular adhesion molecule-1 (ICAM-1) expression PMID: 29115410
  20. anthropometric and physiological parameters do not affect the response of ICAM-1 to exercise in healthy men. PMID: 29696063
  21. 15-LOX-1 expression in colon and prostate cancer cells leads to reduced angiogenesis. These changes could be mediated by an increase in the expression of both ICAM-1 and the anti-angiogenic protein TSP-1. PMID: 28757355
  22. Single nucleotide polymorphisms in ICAM1 (rs1799969) and SERPINB2 (rs6103) genes were found to be protective against thalidomide-induced peripheral neuropathy (TiPN). In children with inflammatory bowel disease, TiPN is common but mild and generally reversible. Cumulative dose seems to be the most relevant risk factor, whereas polymorphisms in genes involved in neuronal inflammation may be protective. PMID: 28817461
  23. analysis of aberrant DNA methylation and hydroxymethylation of the ICAM1 gene promoter in the thyrocytes of Autoimmune Thyroiditis patients PMID: 28388873
  24. Authors demonstrate that the membrane-bound ICAM-1 isoform is necessary and sufficient to promote inflammation-dependent extracellular matrix contraction, which favors cancer cell invasion. Indeed, ICAM-1 mediates generation of acto-myosin contractility downstream of the Src kinases in stromal fibroblasts. PMID: 27901489
  25. Thrombin activated platelet releasing exosomes convey miRNA between cells. miRNA-223 regulates the expression of molecules adhesion including ICAM-1. miRNA-223 downregulated ICAM-1 mainly by impacting NF-kappaB and the MAPK pathway. PMID: 28460288
  26. Data suggest that obese children/adolescents have increased circulating biomarkers of endothelial dysfunction (here, ICAM1) and early signs of renal damage, similarly to children/adolescents with type 1 diabetes (T1D), confirming obesity to be a cardiovascular risk factor as is T1D. PMID: 27246625
  27. ICAM-1 (and IL-17) polymorphisms showed significant association with Guillian-Barre syndrome. PMID: 27595159
  28. Airway ICAM-1 expression is markedly upregulated in CAL group, which could be crucial in rhinoviral and NTHi infections. The parenchymal ICAM-1 is affected by smoking, with no further enhancement in CAL subjects. PMID: 28056984
  29. sVCAM-1 reflects xerostomia in primary Sjogren's syndrome. sICAM-1 and sE-selectin may be additional parameters of secondary Sjogren's syndrome activity. PMID: 29068581
  30. Atorvastatin strengthens Skp2 binding to FOXO1 or ICAM1, leading to ubiquitination and degradation. Skp2-dependent ubiquitination of major pathogenic molecules is the key mechanism for statin's protective effect on endothelial function in diabetes. PMID: 28802579
  31. Augmented expression of endothelial adhesion molecules ICAM1/VCAM1 is involved in the pathophysiology of patients with antiphospholipid syndrome. PMID: 29096830
  32. CD133(+) CD44(+) CD54(+) cellular subpopulation of circulating tumor cells has a prognostic value in colorectal cancer patients with liver metastasis, especially in the survival of CRC patients with liver metastasis who did not undergo surgical treatment for metastasis. PMID: 29105339
  33. Data suggest that the residue volume at phenylalanine (Phe) in alpha1-helix is critical for alpha(L)/beta(2) integrin (CD49a/CD18) activation and binding with soluble/immobilized ICAM1 (intercellular cell adhesion molecule 1). PMID: 29079572
  34. Elevated serum uric acid concentration is significantly associated with inflammation of maternal systemic vasculature as indicated by increased TNF-alpha and ICAM-1 expression in women with preeclampsia. PMID: 26511169
  35. associated with hypertension and stroke risk in women PMID: 27235695
  36. Data indicate that CDH11, ICAM1 and CLDN3 were overexpressed in tumors when compared to normal esophagus, normal gastric and non-dysplastic Barrett's. PMID: 27363029
  37. High levels of serum ICAM-1 was associated with the development of multiple organ failure . High levels of VCAM-1 was associated with both multiple organ failure and in-hospital mortality. PMID: 27701021
  38. matrix stiffness-dependent ICAM-1 clustering is an important regulator of vascular inflammation PMID: 27444067
  39. PD increased CKIP-1 and Nrf2 levels in the kidney tissues as well as improved the anti-oxidative effect and renal dysfunction of diabetic mice, which eventually reversed the up-regulation of FN and ICAM-1 PMID: 28286065
  40. PTPN22 colocalized with its substrates at the leading edge of cells migrating on surfaces coated with the LFA-1 ligand intercellular adhesion molecule-1 (ICAM-1). PMID: 27703032
  41. These results suggest that SHP-2-via association with ICAM-1-mediates ICAM-1-induced Src activation and modulates VE-cadherin switching association with ICAM-1 or actin, thereby negatively regulating neutrophil adhesion to endothelial cells and enhancing their transendothelial migration. PMID: 28701303
  42. Although there was no association between sICAM-1 levels and affective temperament scores, sICAM-1 was related to the state severity of manic symptoms. PMID: 27693464
  43. It is a pro-inflammatory protein. PMID: 28390825
  44. HPMCs are capable of inhibiting growth of gastrointestinal tumors in a mechanism involving the anti-adhesive capabilities of sICAM-1 PMID: 28323210
  45. Following transepithelial migration, neutrophils adhesion to ICAM-1 resulted in activation of Akt and beta-catenin signaling, increased epithelial-cell proliferation, and wound healing. PMID: 26732677
  46. P-Selectin and ICAM-1 have roles in mediating THP-1 monocyte adhesion PMID: 28262902
  47. Dissection of the molecular mechanism revealed that the p38-Notch1 axis was the main downstream signaling pathway in CD54-mediated regulation of cancer stem cells in prostate cancers. PMID: 28042317
  48. We show that knockdown of the expression of mcircRasGEF1B reduces LPS-induced ICAM-1 expression. Additionally, we demonstrate that mcircRasGEF1B regulates the stability of mature ICAM-1 mRNAs. PMID: 27362560
  49. his study shows that two adhesion molecules, shed as soluble forms, are elevated during the acute phase of leptospirosis: E-selectin and s-ICAM1. These molecules may interfere with the process of immune cell recruitment to clear Leptospira at tissue levels. PMID: 28686648
  50. data suggest that CD2AP acts as a negative regulator of ICAM-1 clustering, which limits the formation of ICAM-1 adhesion complexes to prevent uncontrolled neutrophil adhesion and transcellular transmigration. PMID: 28484055

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, ICAM family
Database Links

HGNC: 5344

OMIM: 147840

KEGG: hsa:3383

STRING: 9606.ENSP00000264832

UniGene: Hs.643447

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*