Recombinant Human Interferon alpha-14(IFNA14)

Code CSB-EP011035HUe0
Product Type Recombinant Protein
Size US$162
Uniprot No. P01570
Relevance Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Interferon alpha-H ;LeIF HInterferon lambda-2-H
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Research Area Immunology
Source E.coli
Gene Names IFNA14
Expression Region 24-189aa
Tag Info N-terminal GST-tagged
Mol. Weight 46.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes
Subcellular Location Secreted
Protein Families Alpha/beta interferon family
Database Links

HGNC: 5420

OMIM: 147579

KEGG: hsa:3448

STRING: 9606.ENSP00000369571

UniGene: Hs.93907

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Necroptosis
Natural killer cell mediated cytotoxicity
NOD-like receptor signaling pathway
Toll-like receptor signaling pathway

Related Products

IFNA14 Antibodies

IFNA14 Antibodies for Homo sapiens (Human)

IFNA14 Proteins

IFNA14 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.