Home
Protein
Recombinant Protein
Recombinant Human Interferon alpha-14 (IFNA14)

Recombinant Human Interferon alpha-14 (IFNA14)

Code	CSB-EP011035HUe0
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IFNA14

Uniprot No.

P01570

Research Area

Immunology

Alternative Names

IFN-alpha-14; IFN14_HUMAN; IFNA14; Interferon alpha 14; Interferon alpha H; Interferon alpha-14; Interferon alpha-H; Interferon lambda-2-H; Interferon lambda2H ; LeIF H; LeIFH; MGC125756; MGC125757

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

24-189aa

Target Protein Sequence

CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

46.7kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Regarding your proteins CSB-EP011035HUe0, could you please provide some informations for expression region, tag and sequence?
Also, has the tag ever been removed for this protein?

Very nice to receive your inquiry. The tag of this protein has been successfully removed before.
Recombinant Human Interferon alpha-14(IFNA14)
CSB-EP011035HU >> E.coli N-terminal 6xHis-SUMO-tagged
CSB-EP011035HUe0 >> E.coli N-terminal GST-tagged
CSB-EP011035HUe1 >> E.coli Tag-Free
You can view the full information of sequence and tag on this page.

Target Background

Function

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Gene References into Functions

Gene therapy with plasmids encoding IFN-beta and -alpha14, but not the commonly used -alpha2, confers long-term suppression of HIV-1 replication. PMID: 27729616

Subcellular Location

Secreted.

Protein Families

Alpha/beta interferon family

Database Links

HGNC: 5420

OMIM: 147579

KEGG: hsa:3448

STRING: 9606.ENSP00000369571

UniGene: Hs.93907

Promotions