Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA.Immobilized Human IL3RA at 2 μg/mL can bind Anti-IL3RA recombinant antibody(CSB-RA011658MA1HU).The EC50 is 1.254-1.412 ng/mL.
②IL3RA Recombinant Monoclonal Antibody(CSB-RA011658MA1HU) captured on Protein A Chip can bind Human IL3RA with an affinity constant of 0.202 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

IL3RA

Uniprot No.

P26951

Alternative Names

Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD antigen CD123

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-305aa

Target Protein Sequence

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Mol. Weight

34.5 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

IL3RA (CD123) serves as a critical marker in acute myeloid leukemia and blastic plasmacytoid dendritic cell neoplasm, making it a priority target for therapeutic antibody development and cancer immunotherapy research. This mammalian-expressed extracellular domain (aa 19–305) demonstrates sub-nanomolar binding affinity (KD = 0.202 nM) to a recombinant antibody as measured by surface plasmon resonance, confirming native-like conformational integrity essential for accurate epitope mapping and therapeutic antibody validation studies. The protein supports competitive inhibition assays and blocking antibody screening, with functional ELISA data showing an EC50 of 1.254–1.412 ng/mL when capturing anti-IL3RA antibodies—quantitative benchmarks that enable reliable dose-response characterization in drug discovery campaigns targeting CD123-positive malignancies. Endotoxin levels below 1.0 EU/μg and purity exceeding 90% align with standards expected in ligand-binding assays, SPR affinity measurements, and biolayer interferometry experiments where low background interference is critical for detecting specific receptor-antibody interactions.

Target Background

Function

This is a receptor for interleukin-3.

Gene References into Functions

Family-based whole genome analysis of a family with hereditary pulmonary alveolar proteinosis revealed a homozygous deletion that disrupts CSF2RA, CRLF2, and IL3RA gene in the pseudoautosomal region of the X chromosome in the affected child and one of asymptomatic siblings. PMID: 28233860
Our data define the mechanisms by which SL-101 targets acute myeloid leukemia (AML)and warrant further investigation of the clinical application of SL-101 and other CD123-targeting strategies in AML. PMID: 28096272
Data show that the N-terminal domain (NTD) of interleukin 3 receptor subunit alpha (IL3Ralpha) exhibits exquisite flexibility and a dynamic transition from a high to a low mobility state upon cytokine binding. PMID: 29374162
the oncogenic events of FLT3/ITD happen at a cell stage possessing CD123 PMID: 27465508
Data indicate that CD123 was preferentially expressed among CD33/CD117-positive precursor-T-acute lymphoblastic leukemia (T-ALL). PMID: 26474588
CD123 positivity represents a marker that can facilitate identification of the early T-cell precursor leukemia subtype, but the lack of sensitivity by immunohistochemistry limits the diagnostic utility. PMID: 25906118
CD123 expression is associated with systemic mastocytosis. PMID: 26678095
Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset. PMID: 25779340
CD96 and CD123 are expressed in bone marrow cells of patients with myelodysplastic syndromes PMID: 26642704
High interleukin-3 receptor alpha is associated with blastic plasmacytoid dendritic cell neoplasm. PMID: 25381130
High CD123 expression is associated with systemic mastocytosis. PMID: 25640886
CD123+ plasmacytoid dendritic cells contribute to the sarcoidal granulomas associated with injected permanent fillers. PMID: 25406851
87.8% of AMLs express CD33. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression. PMID: 24927407
Increases in CD34(+)CD38(-)CD123(+) cells may reflect malignant clonal cells with aberrant differentiation, overproliferation, and decreased apoptosis in myelodysplastic syndrome, which were similar to acute myeloid leukemia. PMID: 24846193
In the present study we analyzed the expression of four cell surface antigens relevant to human hematopoiesis-CD90, CD96, CD117, and CD123-in bone marrow from pediatric acute myeloid leukemia patients and normal control subjects. PMID: 24751333
We conclude the hMICL/CD123-based MFC assay is a promising MRD tool in AML. PMID: 24152218
Results suggest that CD123 results suggest that CD123 chimeric antigen receptors (CARs) T cells are a promising immunotherapy for the treatment of high-risk acute myeloid leukemia (AML). PMID: 24030378
CD123 is a useful immunohistochemical marker to facilitate diagnosis of acute graft-versus-host disease in colon. PMID: 23791208
CD123 expression in acute myeloid leukemia is associated with underlying FLT3 and NPM1 mutations. PMID: 22914610
We recommend immunohistochemical analyses for CD123, CD56 and CD4 inblastic plasmacytoid dendritic cell neoplasm patients, particularly in cases where the initial bone marrow study indicates normal morphology. PMID: 23470050
we report that IL3 receptor alpha (IL3Ralpha) and NOTCH play integral roles in the host cell type-specific regulation of PROX1 by Kaposi sarcoma herpes virus PMID: 22719258
High levels of CD34+CD38low/-CD123+ blasts are predictive of an adverse outcome in acute myeloid leukemia PMID: 21933861
The pattern of CD123 staining can be a useful feature to distinguish hypertrophic lupus erythematosus, squamous cell carcinoma and hypertrophic actinic keratosis. PMID: 21955314
These findings support the usefulness of CD123 and CD103 to aid in the differential diagnosis of B-cell lymphoproliferative disorders PMID: 21917686
assessment of CD123 expression is useful for supporting the diagnosis of classical Hodgkin lymphoma PMID: 20809502
Over expression of IL-3Ralpha and truncated mutation of hbetac may be involved in proliferation and differentiation block in NB4 cells. PMID: 21176354
Interleukin 3 receptor alpha is a cell-surface marker present on leukemia-initiating cells of patients with Fanconi anemia-acute myeloid leukemia, and may be a promising therapeutic target for these patients. PMID: 21330473
CD123 was highly expressed in the bone marrow of the patients with myelodysplastic syndrome, significantly correlated with the proportion of bone marrow blasts, and thus might be the marker of MDS malignant clone. PMID: 20819538
Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood. PMID: 20888334
Data show high expression of CD86 and CD11C, moderate expression of CD1a and CD123, low levels of CD83 on dendritic cells after induction by GM-CSF and IL-4. PMID: 19257981
Elevated expression in acute myelogenous leukemia is associated with enhanced blast proliferation, increased cellularity, and poor prognosis PMID: 12351411
Bioinformatic study of IL-3 Ralpha & GM Ralpha subunits found a tripeptide sequence near the conserved proline-rich domain which was a key difference between them. Cross-exchange of equivalent subunits altered function compared to wild-type receptors. PMID: 12384414
Analysis of the 5' promoter of the hIL-3Ra gene. PMID: 12504125
IL-3Ralpha mRNA is upregulated by IL-3, IL-5, and GM-CSF in human eosinophils PMID: 12943658
IL-3 receptor activation is not essential for BCR-ABL-induced myeloproliferative diseases PMID: 14500898
REVIEWS overexpression of the IL-3Ralpha chain as one of the mechanisms contributing to the development of a highly malignant leukemic phenotype and evidence that IL-3Ralpha is a marker of leukemic stem cells PMID: 14671644
Therefore, these data provide strong evidence that integrin-dependent STAT5A activation controls IL-3-mediated proliferation. PMID: 15795318
role in modulating tumor neovascularization in conjunction with VEGFR (KDR) PMID: 16007196
Sequencing of interleukin 3 receptor alpha in an independent case-control cohort revealed both common intronic haplotypes and several novel, rare missense variants associated with schizophrenia. PMID: 17522711
variants in the gene coding for its receptor (IL-23R) are strongly associated with Crohn's disease PMID: 18047539
A small but significant contribution of the IL3RA polymorphism to susceptibility to schizophrenia, suggesting that the IL3 pathway may be involved in schizophrenia. PMID: 18547720
CD123+ MDCs were an early-stage immature DC subset, with a significant tumor-inhibiting activity partially via involvement of enhanced cytoplasmic TRAIL. PMID: 18555589
our family-based association study revealed a small but significant contribution of the IL3RA variants to susceptibility to schizophrenia in a Chinese population (Han) PMID: 19281803
overexpression of CD123 is an aberrant phenotype present in a subset of precursor-B ALL with hyperdiploid genotype PMID: 19454491
Progression of cutaneous squamous cell carcinoma in immunosuppressed patients is associated with reduced CD123+ and FOXP3+ cells in the perineoplastic inflammatory infiltrate. PMID: 19614769
the less mature hematogones (dim CD45+) that express CD34 lack CD123 expression, whereas the more mature hematogones (moderate CD45+) lack CD34 but always express CD123. PMID: 19762535

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Protein Families

Type I cytokine receptor family, Type 5 subfamily

Database Links

HGNC: 6012

OMIM: 308385

KEGG: hsa:3563

STRING: 9606.ENSP00000327890

UniGene: Hs.632790

Code	CSB-MP011658HU1d7
Abbreviation	Recombinant Human IL3RA protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Human IL3RA at 2 μg/ml can bind Anti-IL3RA recombinant antibody(CSB-RA011658MA1HU).The EC₅₀ is 1.254-1.412 ng/mL. Biological Activity Assay Activity IL3RA Recombinant Monoclonal Antibody(CSB-RA011658MA1HU) captured on Protein A Chip can bind Human IL3RA with an affinity constant of 0.202 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage