Recombinant Human Interleukin-7 receptor subunit alpha (IL7R), partial

In Stock
Code CSB-MP011670HU1d9
Abbreviation Recombinant Human IL7R protein, partial
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CDw127
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
21-239aa
Target Protein Sequence
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.2 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).
Gene References into Functions
  1. No significant association between the IL7RA C/T (rs6897932) and IL12B A1188C (rs3212227) gene polymorphisms and multiple sclerosis susceptibility was observed PMID: 30069682
  2. Increased signal transduction and proliferation in response to IL-7 was found in 'TT' compared to 'CC' IL7RA homozygous HIV-infected individuals providing a mechanistic explanation of the effect of rs6897932 T-allele on CD4+ T cell recovery in HIV infection. PMID: 28181541
  3. EZH2 mutations coexisted with mutations of NOTCH1, IL7R, and PHF6 in the two Adult T-cell Acute Lymphoblastic Leukemia patients, and they responded poorly to chemotherapy and experienced difficult clinical histories and inferior outcomes PMID: 28747286
  4. apicidin induced the acetylation of Forkhead box-containing protein, O subfamily 1, which acts as a repressor at the IL7R promoter, accompanied with depleted active histone modifications based on chromatin immunoprecipitation assay. Taken together, these results demonstrated that targeting oncogenic IL7R in ESCC by HDAC inhibitors may be a valuable therapeutic approach. PMID: 29749437
  5. In all, IL7RA locus polymorphisms could play an important role in the predisposition to multiple sclerosis, which could contribute to a better understanding the pathogenesis of multiple sclerosis. PMID: 28446795
  6. The results confirm the association between IL7RA exon 6 sequence polymorphisms and increased susceptibility to multiple sclerosis. PMID: 28582853
  7. The IL7RA rs6897932 polymorphism seems to be related to increased risk of liver fibrosis progression in HCV-infected patients. Thus, the rs6897932 polymorphism could be related to the physiopathology of chronic hepatitis C(CHC) and might be used to successfully stratify the risk of CHC progression. PMID: 29742149
  8. indicate that IL7RhighSH2B3low expression distinguishes a novel subset of high-risk B-acute lymphoblastic leukemia associated with Ikaros dysfunction PMID: 27322554
  9. CD127 is a useful surface marker to isolate donor-antigen-specific-Tregs in operational tolerance after liver transplantation PMID: 27105585
  10. Data demonstrate that IL-7R expression is regulated by HBX via NF-kappaB and Notch1 pathways to facilitate the activation of intracellular pathways and expression of associated molecules, and contribute to proliferation and migration of hepatoma cells. PMID: 27821177
  11. We show that heterozygous IL7R exon deletions are common in T-B+NK+ SCID and are detectable by WES. They should be considered if Sanger sequencing fails to detect homozygous or compound heterozygous IL7R SNVs or INDELs. PMID: 27807805
  12. The results of this study showed that IL-17 receptor (IL-17R) were clearly up regulated in mesial temporal lobe epilepsy at both mRNA and protein levels, compared with control. PMID: 27609289
  13. the coding regions of 17 genes involved in the regulation of the immune response were determined by massive parallel sequencing. The analysis revealed 39 nonsynonymous SNPs that lead to amino acid substitutions, including the following informative genetic markers: PTPN22 c.1858C>T (rs2476601), TLR4 c.896A>G (rs4986790) and TLR4 c.1196C>T (rs4986791), IL7R c.197T>C (rs1494555) and IL7R c.412G>A (rs1494558). PMID: 28537236
  14. The interleukin-7 receptor alpha (IL-7Ralpha) signaling pathways are prime therapeutic targets because these pathways harbor genetic aberrations in both T-cell ALL and B-cell precursor ALL. Therapeutic targeting of the IL-7Ralpha signaling pathways may lead to improved outcomes in a subset of patients. PMID: 27268088
  15. These studies provide in vivo evidence that IL-7Ralpha signals positively regulate normal human B-cell production and proliferation beyond the fetal period and suggest that TSLP can replace IL-7 in providing these signals. PMID: 27325567
  16. Study showed that a genetic variant in the 5' UTR of DDX39B reduces translation of DDX39B mRNAs and increases multiple sclerosis (MS) risk. Importantly, this DDX39B variant showed strong genetic & functional epistasis with allelic variants in IL7R exon 6; study establishes the occurrence of biological epistasis in humans & provides mechanistic insight into the regulation of IL7R exon 6 splicing & its impact on MS risk. PMID: 28340352
  17. study identifies casein kinase 2 as a major player in the effects of interleukin-7 and interleukin-7 receptor in T-cell acute lymphoblastic leukemia PMID: 27470599
  18. IL7Ralpha level was higher in asthmatic than in nonasthmatic children. PMID: 26999524
  19. Meta-analysis demonstrated that the IL7R T244I polymorphism was associated with susceptibility to multiple sclerosis PMID: 27456877
  20. This study suggested that the IL7R C allele was associated with an increased risk of MS and larger-scale studies of populations are needed to explore the roles played by the IL7R T244I polymorphism during the pathogenesis of multiple sclerosis. PMID: 27188999
  21. the variant of IL-7RA (rs6897932) was associated with NMO especially NMO-IgG positive patients while the variant of IL-7 (rs1520333) with MS patients. PMID: 26608987
  22. this study shows that in human CD8 T cells that IL-7 binding to its receptor induces CD127 internalization via clathrin-mediated endocytosis, transport of the receptor from early to late endosomes and ultimately degradation of CD127 by the proteasome. PMID: 26272555
  23. Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia. PMID: 26852660
  24. results suggest that LNK suppresses IL-7R/JAK/STAT signaling to restrict pro-/pre-B progenitor expansion and leukemia development, providing a pathogenic mechanism and a potential therapeutic approach for B-ALLs with LNK mutations. PMID: 26974155
  25. Pretransplant recipient circulating CD4+CD127lo/-TNFR2+ Treg cell is potentially a simpler alternative to Treg cell function as a pretransplant recipient immune marker for acute kidney injury. PMID: 26425877
  26. Data suggest that the lack of IL-7 receptor alpha chain (IL7Ralpha) expression, associated with hypermethylation of the IL7R promoter, in T cells restricts T-cell development in Schimke immuno-osseous dysplasia (SIOD) patients. PMID: 26499378
  27. Substitution of the first 10 Nterminal residues or deletion of residues 17-21 prevented Tat from interacting with and down regulating CD127 from the cell surface. PMID: 25986373
  28. cooperation between IL-7R and alpha2beta1 integrin can represent an important pathogenic pathway in Th17-osteoclast function associated with inflammatory diseases PMID: 26408663
  29. This study then provides evidence that soluble factor(s) are responsible for low CD127 expression on circulating CD8 T-cells in HIV+ individuals and further implicates Tat in suppressing this receptor essential to CD8 T-cell proliferation and function. PMID: 25033393
  30. Findings indicate that IL7 receptor (IL7R) and c-myc expression as intrinsic biomarkers that can predict the fate of CD8+ T effector cells after adoptive transfer. PMID: 26100671
  31. A girl with severe combined immunodeficiency was a compound heterozygote for 2 new frameshift mutations, c.589_598del10 p.P197fsX44 and c.993delA p.Q331fsX2. Each parent carried one of these. PMID: 26123418
  32. the influence of IL-7 receptor alpha-chain (IL-7Ralpha) gene haplotypes in donors on the outcome of haematopoietic cell transplantation, was investigated. PMID: 25352021
  33. Data indicate that individuals carrying the interleukin-7 receptor A/A genotype were more susceptible to diarrhea. PMID: 25366767
  34. This study demonstrated that rs6897932 in IL7Ra gene is associated with the progression of multiple sclerosis in Central European Slovak population. PMID: 25903732
  35. The present study highlights perturbed IL-7/IL-7R T cell signaling through STAT5 as a potential mechanism of T cell exhaustion in chronic T. cruzi infection. PMID: 25769928
  36. rs6897932 allele of interleukin-7 receptor alpha is not associated with general inflammation, and reported associations between T-allele in rs6897932 with several autoimmune diseases may be mediated through effects on restricted part of the immune system PMID: 25421942
  37. Sustained virological response correlates with higher expression of CD127, lower T cell exhaustion status and better HIV and HCV proliferative responses at baseline. PMID: 25007250
  38. Our analysis revealed that none of these 35 samples carried an IL7R mutation in exon 6. Whether differences in the genetic makeup of adult and childhood T-ALL explain the differential response to therapy remains to be determined PMID: 24678068
  39. CD127(hi) effluxer CD8(+) T cells represent a novel population of early memory T cells resident in BM with properties required for long-lived memory PMID: 25231631
  40. Early Omenn syndrome can be observed in patients with IL7R mutations, and autoimmune cytopenias could also complicate the clinical course of SCID babies with this type of defect. PMID: 24759676
  41. CD8 positive T lymphocytes expressing CD127 exhibit increased distribution frequency and distinct functional characteristics that correlate with clinicopathological status in oral neoplasms. PMID: 24465587
  42. Il7 receptor SNP rs6897932 may be associated with increased systemic lupus erythematosus risk in Chinese populations. PMID: 24242875
  43. data suggest that lnc-IL7R contributes another layer of complexity in regulation of the inflammatory response PMID: 24723426
  44. Measurement of the sIL-7R/IL-7 axis will help in guided immune monitoring after HSCT and guided interference with sIL-7R may be explored in GVHD management. PMID: 24946690
  45. we report noncysteine in-frame mutations in IL7R and CRLF2 located in a region of the transmembrane domain closer to the cytosolic domain in acute lymphoblastic leukemias PMID: 24787007
  46. the results indicate that the genetic variation of IL7R may be associated with inflammatory demyelinating diseases such as Multiple sclerosis (MS) and neuromyelitis optica (NMO) in the population studied. PMID: 24337176
  47. CD127 expression is differentially modulated on CD4+ and CD8+ T-cells in the course of T1D. PMID: 24348676
  48. The findings indicate that genetic variants of IL7RA result in haplotype-associated differential responsiveness to immunological stimuli that influence multiple sclerosis susceptibility not exclusively by varying levels of soluble IL-7RA. PMID: 23985573
  49. The IL7R, TNFRSF1A, and GPC5 polymorphisms tended to be associated with having a second event of Multiple sclerosis within a year. PMID: 24130709
  50. The IL7R polymorphism was associated with reduced odds of multiple sclerosis attacks involving the brainstem/cerebellum as were the TNFRSF1A and IL12A polymorphisms. PMID: 24130718

Show More

Hide All

Involvement in disease
Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID); Multiple sclerosis 3 (MS3)
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Secreted.
Protein Families
Type I cytokine receptor family, Type 4 subfamily
Database Links

HGNC: 6024

OMIM: 146661

KEGG: hsa:3575

STRING: 9606.ENSP00000306157

UniGene: Hs.591742

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*