Recombinant Human Lymphotoxin-alpha (LTA), partial,Biotinylated

Code CSB-MP013218HU-B
Abbreviation Recombinant Human LTA protein, partial, Biotinylated
MSDS
Size $166
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
35-205aa
Target Protein Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.7 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo.
Gene References into Functions
  1. The LTA were significantly increased in SZ patients, but no significant difference in the mRNA levels of LTA was observed between SZ patients and NC subjects. PMID: 28476335
  2. There are independent and additive interactions between LTalpha +252 G/G genotype, chronic viral hepatitis, and habits of substance use on risk of hepatocellular carcinoma. PMID: 28738973
  3. Independent and additive interaction between polymorphisms of TNFalpha -308 and lymphotoxin alpha +252 on risk of hepatocellular carcinoma related to hepatitis B has been reported. PMID: 28865603
  4. The C allele for rs1042522 in p53 was genetically associated with a higher risk for RD but not for PVR in this cohort. This is the first association study attempting replication of PVR-associated risk alleles in a nonwhite population. PMID: 28106707
  5. The results of this study showed that neither -252 G/A nor -804 C/A polymorphism of the LTA gene was found to be associated with overall stroke as well as any subtype of IS excluding SVD in North Indian population. PMID: 26707826
  6. this study found an association between the single nucleotide polymorphism LTA +252 with the development of sepsis in Colombian patients PMID: 27592234
  7. Fequencies of polymorphic allele and genotypes for the lymphotoxin-alpha gene, position +252 (rs909253), in Brazilian women with preeclampsia PMID: 26561241
  8. The allelic frequencies of LTA SNPs were found to be significantly associated with the risk of oral cancer and precancerous lesions PMID: 27312561
  9. rs909253 in LTA was identified to be significantly associated with ankylosing spondylitis susceptibility in this study population, but no significant association was found between ankylosing spondylitis risk and LTA rs2239704 or rs2229094 PMID: 28489756
  10. study showed that heterozygous variant (AG) genotype of TNF-beta was associated with persistent primary immune thrombocytopenia, when compared with controls PMID: 26761582
  11. a positive correlation of HLA-DRB1*12 and a negative correlation of HLA-DRB1*13 with younger patientsTNFb4 allele's negative association with older patients displaying higher PSA levels, higher GS and positive surrounding tissue involvement; positive association of TNFb5 allele for both older and younger patients PMID: 27102235
  12. the present study suggests LTa +252G as a risk alleles for disease susceptibility associated with higher serum levels of LTa and concomitant discrete clinical features among Indian systemic lupus erythematosus patients in India PMID: 27838362
  13. this study shows that TNF-b is elevated in wound exudates of patients with hidradenitis suppurativa PMID: 27819528
  14. LTA -804C/A gene polymorphism is not found to be associated with the susceptibility of ischemic stroke in both Asian as well as in Caucasian population. PMID: 27411794
  15. After multivariable analysis TNF-alpha polymorphism showed no consistent association with leukemia. CONCLUSIONS: This meta-analysis suggests that the LT-alpha +252 AA polymorphism is associated with the risk of leukemia PMID: 27647233
  16. Tumor Necrosis Factor and Lymphotoxin in Regulation of Intestinal Inflammation. PMID: 27914457
  17. joint effects of these CRP, TNF-alpha, and LTA risk alleles with physical inactivity in elders were observed, suggesting that physical activity may modulate effects of genotypes on handgrip strength. PMID: 27056089
  18. No association was found between two promoter variants of TNF and LTA, and diabetic retinopathy in a large cohort of Caucasian patients with type 1 diabetes and type 2 diabetes PMID: 26821796
  19. Polymorphism +252 LT gene did not show any significant association with COPD. PMID: 26932696
  20. TNFB+252G/A was associated with presence of immune thrombocytopenia. PMID: 26076780
  21. LTalpha plays a role in malignant angiogenesis and disease progression in Cutaneous T cell lymphoma and may serve as a therapeutic target in this disease. PMID: 25915535
  22. LTA polymorphism is associated with genetic susceptibility of systemic lupus in Asians, but not in rheumatoid arthritis. PMID: 25931031
  23. Studied the association between immuno-modulatory gene polymorphisms (including LTA) and risk for nasal NK/T-cell lymphoma in a Chinese population. Found The LTA +252 GA + AA genotypes were associated with increased risk for NK/T-cell lymphoma. PMID: 26108796
  24. TNF-beta NcoI polymorphism, by itself, was not associated with increased stroke susceptibility. But the homozygous genotype for the allele TNFB2 was associated with higher expression of classical inflammatory and metabolic markers of stroke. PMID: 25063351
  25. These results support an association between ANKK1 and LTA genetic markers and vulnerability to schizophrenia and show the potential influence of just one copy of the mutant C or G allele in the Egyptian population. PMID: 26114114
  26. Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays. PMID: 26554163
  27. TNF-alpha (-308G/A), TNF-beta (+252A/G) and IL-10 (-1082G/A, -819C/T and -592C/A) polymorphisms are associated with the susceptibility of oral lichen planus. PMID: 26221924
  28. Elite controllers of HIV infection present marginal zone-like B-cell populations which IL-10 and LT-alpha expression profiles may favour homeostasis of immune responses and lymphoid microenvironments. PMID: 25003989
  29. Biotin-pulldown assay showed that HuR specifically interacts with the 3'-untranslated region (3'-UTR) of the LTalpha mRNA PMID: 25980610
  30. The AA genotype of LT-alpha + 252 was significantly associated with shortened overall or leukemia-free survival in patients with myelodysplastic syndrome with excess blasts. PMID: 23931336
  31. MTHFR, TGFbeta1, and TNFB polymorphisms are not significantly associated with the risk of osteoporosis in rheumatoid arthritis. PMID: 25981594
  32. statistical evidence for the interactions between 1) TNF/LTA SNP rs2229094 and depression symptoms for average pain intensity and duration and 2) IL1B two SNP diplotype and kinesiophobia for average shoulder pain intensity PMID: 24598699
  33. The TNFB2/B2 genotype of TNF-beta NcoI polymorphism was associated with increased inflammatory and metabolic markers and this association was different according to sex of MS patients. PMID: 25173940
  34. Review/Meta-analysis: Suggest lymphotoxin-alpha +252A/G gene polymorphism is a risk factor for NHL in North Americans, and this polymorphism may contribute to diffuse large B cell lymphoma susceptibility. PMID: 24610621
  35. Combinations of cytokine gene network polymorphic markers as potential predictors of myocardial infarction PMID: 25735143
  36. The findings appear to support the hypothesis that genetic variability of 252A>G polymorphism in TNF-beta region may modulate risk of migraine in the population of Asian ancestry. PMID: 24959879
  37. Studies indicate that tumor necrosis factors TNF-alpha/TNF-beta and their receptor TNFR1 and TNFR2 play a regulatory role of different immune cells. PMID: 24896334
  38. This indicates an association between polymorphism of the TNF-beta gene and post-operative sepsis, suggesting the TNFB2/B2 genotype as a high-risk factor for the development of sepsis after elective surgery. PMID: 24796628
  39. IL-6-174 SNP is rare or not seen in the Han population in Guangzhou, so SNP at this locus cannot be selected for disease association analysis. PMID: 25140780
  40. Our findings suggest that Hodgkin and Reed Sternberg cell-derived LTalpha is an important mediator that contributes to T cell recruitment into lesional lymph nodes in Hodgkin lymphoma. PMID: 25139349
  41. TNFB2 allele was associated with the presence of multiple sclerosis independently of HLA-DRB1 in white patients and the TNFB2/B2 genotype was associated with increased TNF-alpha levels in white and brown patients. PMID: 24696164
  42. TNFB +252A/G and exon 3 C/A polymorphisms are associated with vitiligo susceptibility PMID: 24312346
  43. A significant association was detected between LT-alpha +249A/G and increased risk of diabetes, in particular for young-onset patients PMID: 24233435
  44. TNF and LTA genetic polymorphisms contribute to SLE susceptibility in the Egyptian population and are associated with disease characteristics. PMID: 24420856
  45. Polymorphisms of the LTA gene can probably be used with other genetic markers together to identify individuals at high susceptibility to myocardial infarction. PMID: 24642747
  46. These results suggest for the first time that TNF-beta is involved in microenvironment inflammation in chondrocytes during rheumatoid arthritis PMID: 24283517
  47. our meta-analyses suggested that the LTA rs1041981, rs2239704 and rs2229094 polymorphisms contributed to the increased risk of cancers. PMID: 24349304
  48. This study provides evidence for rs1799724 at the LTA/TNFalpha locus as a susceptibility factor for idiopathic achalasia. PMID: 24259423
  49. TNF-alpha -308 A/G and LT-alpha +252 A/G polymorphisms are associated with susceptibility to sarcoidosis in an European population.[META-ANALYSIS] PMID: 24197700
  50. The TNF-beta gene A252G polymorphism might be a potential risk factor for the development of sarcoidosis. (Meta-analysis) PMID: 24244632

Show More

Hide All

Involvement in disease
Psoriatic arthritis (PSORAS)
Subcellular Location
Secreted. Membrane. Note=The homotrimer is secreted. The heterotrimer is membrane-associated.
Protein Families
Tumor necrosis factor family
Database Links

HGNC: 6709

OMIM: 153440

KEGG: hsa:4049

STRING: 9606.ENSP00000403495

UniGene: Hs.36

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*