Recombinant Human Lymphotoxin-alpha(LTA) (Active)

In Stock
Code CSB-AP004941HU
Product Type Tumor Necrosis Factor
Size $153Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P01374
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer 0.2 μm filtered solution of PBS, PH7.4, Lyophilized
Alias Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Research Area Cancer
Source E.coli
Gene Names LTA
Expression Region 35-205aa
Tag Info Tag-Free
Mol. Weight 18.8 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Involvement in disease Psoriatic arthritis (PSORAS)
Subcellular Location Secreted, Membrane
Protein Families Tumor necrosis factor family
Database Links

HGNC: 6709

OMIM: 153440

KEGG: hsa:4049

STRING: 9606.ENSP00000403495

UniGene: Hs.36

Pathway NF-kappa B signaling pathway
TNF signaling pathway

Related Products

LTA Antibodies

LTA Antibodies for Human

LTA Antibodies for Homo sapiens (Human)

LTA Proteins

LTA Proteins for Homo sapiens (Human)

LTA ELISA Kit

LTA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.