Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B (CSB-MP023978HU2), the EC50 is 1.632-2.699 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1(CSB-MP023977HU1), the EC50 of human LTA protein is 4.409-6.797 ng/ml.
Alternative Names
(LT-alpha)(TNF-beta)(TNFB)(TNFSF1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
35-205aa
Target Protein Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human LTA amino acid Leu35-Leu205, with an N-terminal linker, a TEV (tobacco etch virus)+linker, and an N-terminal human 6xHis-tag, was expressed in mammalian cells. The resulting product is the recombinant human LTA antigen. The purity of this LTA protein reaches up to 95% detected by SDS-PAGE. This protein ran at a molecular weight of about 21 kDa by SDS-PAGE due to glycosylation. Its endotoxin content is less than 1.0 EU/ug determined by the LAL method. The bioactivity of this recombinant LTA protein was measured in the functional ELISA. This LTA protein can bind to the human TNFRSF1B or human TNFR1, with the EC50 constant of 1.632-2.699 ng/ml and 4.409-6.797 ng/ml, respectively. And it is available now.
LTA, the closest homolog to TNFα, has specific roles in the development and function of the immune system, mainly in lymphoid organ development, organization and maintenance of lymphoid microenvironments, host defense, and inflammation.