Recombinant Human MARCKS-related protein(MARCKSL1)

Code CSB-EP013494HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P49006
Relevance Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE
Research Area Signal Transduction
Source E.coli
Gene Names MARCKSL1
Protein Names Recommended name: MARCKS-related protein Alternative name(s): MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate Short name= Mac-MARCKS Short name= MacMARCKS
Expression Region 1-195aa
Tag Info N-terminal GST-tagged
Mol. Weight 46.5kDa
Protein Description Full Length of BC066915
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems (By similarity).
Subcellular Location Cytoplasm, Cell membrane, Membrane, Lipid-anchor
Protein Families MARCKS family
Database Links

HGNC: 7142

OMIM: 602940

KEGG: hsa:65108

STRING: 9606.ENSP00000362638

UniGene: Hs.75061

Pathway Fc gamma R-mediated phagocytosis

Related Products

MARCKSL1 Antibodies

MARCKSL1 Antibodies for Homo sapiens (Human)

MARCKSL1 Antibodies for Human

MARCKSL1 Proteins

MARCKSL1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.