Recombinant Human Mitogen-activated protein kinase kinase kinase 14 (MAP3K14), partial

In Stock
Code CSB-EP013422HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
MAP3K14
Uniprot No.
Research Area
Biochemicals
Alternative Names
Serine/threonine-protein kinase NIK NF-kappa-beta-inducing kinase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
400-655aa
Target Protein Sequence
ATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRAL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
35.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The pipeline for the recombinant Human MAP3K14 protein production in e.coli cells consists of the following consecutive steps: construction of the expression vector encoding the Human MAP3K14 protein (400-655aa), its transformation into e.coli cells, high-density cultivation and induction of the positive cells, cell lysis, and expression analysis. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. The resulting recombinant Human MAP3K14 protein is purified from the cell lysate through affinity purification, and its purity is greater than 85% determined by the SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lymphotoxin beta-activated kinase which seems to be exclusively involved in the activation of NF-kappa-B and its transcriptional activity. Promotes proteolytic processing of NFKB2/P100, which leads to activation of NF-kappa-B via the non-canonical pathway. Could act in a receptor-selective manner.
Gene References into Functions
  1. A TRAF3-NIK axis differentially regulates viral DNA vs RNA pathways in innate immune signaling. PMID: 30018345
  2. Data show that breast cancer stem cells (BCSCs) expressed higher levels of NF-kappaB-inducing kinase (NIK). PMID: 27876836
  3. These findings highlight the importance of NIK in tumor pathogenesis and invite new therapeutic strategies that attenuate mitochondrial dysfunction through inhibition of NIK and Drp1. PMID: 27889261
  4. results suggest that changes in the relative concentrations of RelB, NIK:IKK1, and p100 during noncanonical signaling modulate this transitional complex and are critical for maintaining the fine balance between the processing and protection of p100. PMID: 27678221
  5. report a detailed state-of-the-art mass spectrometry-based protein-protein interaction network including the noncanonical NF-kappaB signaling nodes TRAF2, TRAF3, IKKalpha, NIK, and NF-kappaB2/p100; also provide a differential interactome of NIK mutants that cause immunodeficiency PMID: 27416764
  6. OLFM1 is a negative regulator of non-canonical NF-kappaB signalling by interacting with and inhibiting NIK. Thus, OLFM1 may serve as a valuable biomarker and therapeutic target for colorectal cancer (CRC) patients. PMID: 27555280
  7. The expression of OTUD7B and NIK were negatively correlated in non-small cell lung cancer tumor samples. the higher expression of NIK was related to more lymph node metastasis and later TNM stage. high OTUD7B/low NIK index can predict an good prognosis. PMID: 27499151
  8. NIK expression was significantly increased in the tumor tissue of patients with breast carcinoma, which may be an important factor that affects the prognosis of these patients. PMID: 26823811
  9. This study identified two novel independent loci (MAP3K14 and CARD9) strongly associated with joint damage in Mexican Americans and European Americans and a few shared loci showing suggestive evidence for association. PMID: 26498133
  10. The forced expression of NDRG2 in ATL cells down-regulates not only the canonical pathway by inhibiting AKT signaling but also the non-canonical pathway by inducing NF-kappaB-inducing kinase (NIK) dephosphorylation via the recruitment of PP2A PMID: 26269411
  11. NIK(+) endothelial cells may play an important role in the persistence of synovitis PMID: 26178280
  12. Data suggest microRNA302c, but not microRNA520e, promotes replication of influenza A virus H3N2 although the two microRNAs target same site of NFkappaB-inducing kinase (MAP3K14) 3prime untranslated region; studies were conducted in lung epithelial cells. PMID: 26602079
  13. by demonstrating a critical role of NIK in mediating NF-kappaB activation and BAG3 induction upon ST80/Bortezomib cotreatment, our study provides novel insights into mechanisms of resistance to proteotoxic stress in RMS PMID: 25766331
  14. Loss-of-function mutations in NIK can cause B-cell lymphopenia, hypogammaglobulinemia, impaired ICOSL expression, and disordered T helper cell and NK cell function. PMID: 25406581
  15. Membrane attack complexes activate noncanonical NF-kappaB by forming a novel Akt(+)NIK(+) signalosome on Rab5(+) endosomes. PMID: 26195760
  16. Authors show that activation of NF-kappaB by Kaposi's sarcoma-associated herpesvirus K15 protein involves the recruitment of NF-kappaB-inducing kinase (NIK) and IKK alpha/beta to result in the phosphorylation of p65/RelA on Ser536. PMID: 25187543
  17. NIK plays a key role in constitutive NF-kappaB activation and the progression of ovarian cancer cells PMID: 24533079
  18. Identification and function of the NIK IAP binding motif, which promotes c-IAP1-dependent ubiquitylation of NIK. PMID: 25246529
  19. These studies provide evidence for a role of NF-kappaB-inducing kinase (NIK) and subsequent non-canonical NF-kappaB signalling in pathological angiogenesis PMID: 25043127
  20. Results show that nuclear factor-kappa B inducing kinase has a role in graft-versus-host disease by maintaining the viability of activated alloreactive T lymphocytes. PMID: 20823135
  21. NIK is a new therapeutic target for Mantle cell lymphoma treatment, particularly for lymphomas that are refractory to B cell receptor pathway inhibitors. PMID: 24362935
  22. A pivotal role for NIK in nuclear factor kappa B activation and regulation of gene expression in T-cell lymphoma. PMID: 23536439
  23. TRAF2/NIK/NF-kappaB2 pathway regulates pancreatic ductal adenocarcinoma cell tumorigenicity PMID: 23301098
  24. APPL1 regulates basal NF-kappaB activity by modulating the stability of NIK, which affects the activation of p65. PMID: 22685329
  25. we found that NIK and the noncanonical pathway are very prevalent in Hodgkin lymphoma PMID: 22968463
  26. study shows API2-MALT1 fusion oncoprotein induces proteolytic cleavage of NF-kappaB-inducing kinase (NIK); resulting deregulated NIK activity is associated with constitutive noncanonical NF-kappaB signaling, enhanced B cell adhesion and apoptosis resistance PMID: 21273489
  27. a molecular basis for the recent observation of gain-of-function activity for an N-terminal deletion mutant (DeltaN324) of NIK, leading to constitutive non-canonical NF-kappaB signaling with enhanced B-cell adhesion and apoptosis resistance. PMID: 22718757
  28. NIK is one of the direct target genes of miR-520e. PMID: 22105365
  29. NIK mediates both beta-catenin and NF-kappaB regulated transcription to modulate melanoma survival and growth PMID: 21963849
  30. Genetic lesions of the TRAF3 and MAP3K14 genes in classical Hodgkin lymphoma. PMID: 22469134
  31. NIK activity in nonhematopoietic cells controls Th2 cell development and prevents eosinophil-driven inflammatory disease, most likely using a signaling pathway that operates independent of the known NIK substrate IKKalpha. PMID: 22474019
  32. Cigarette smoke and TNFalpha increase NIK levels causing phosphorylation of IKKalpha, which leads to histone acetylation. PMID: 21887257
  33. A role for NF-kappaB noncanonical pathway activation in modulating diabetes-induced inflammation in renal tubular epithelium. PMID: 21869881
  34. Adiponectin treatment inhibited NIK-induced NF-kappaB activation and restored insulin sensitivity by restoring phosphatidylinositol 3 kinase activation and subsequent serine-threonine kinase phosphorylation. PMID: 21846802
  35. findings suggest that the CC genotype of NIK rs7222094 is associated with increased mortality and organ dysfunction in septic shock patients, perhaps due to altered regulation of NF-kappaB pathway genes, including CXCL10 PMID: 21257964
  36. plays a key role in constitutive NF-kappaB activation in non-small cell lung cancer cells PMID: 20338663
  37. TNF-alpha and carrageenan in combination act to increase NIK phosphorylation, thereby increasing activation of the non-canonical pathway of NF-kappaB activation PMID: 20937806
  38. Data suggest that NIK and genes induced by the NIK-mediated constitutive NF-kappaB activation could be therapeutic targets of basal-like breast cancer. PMID: 20735436
  39. An atypical E3 ligase zinc finger protein 91 stabilizes and activates NF-kappaB-inducing kinase via Lys63-linked ubiquitination. PMID: 20682767
  40. Data show that NIK with mutations in the IKKalpha-targeted serine residues was more stable than wild-type NIK and resulted in increased noncanonical NF-kappaB signaling. PMID: 20501937
  41. These results suggest that augmentation of NF-kappaB-inducing kinase, IkappaB kinase-alpha, and pH3 in response to oxidative stress is involved in cell death after cerebral ischemia (or stroke). PMID: 20125184
  42. the LTbetaR modifies the ubiquitin:NIK E3 ligase, and also acts as an allosteric regulator of the ubiquitin:TRAF E3 ligase PMID: 20348096
  43. Data provide analysis of the IKK/NIK inter-relationship and its impact on NF-kappaB control by mathematical modelling. PMID: 19909783
  44. results demonstrate that IKK2 is essential for dendritic cell activation induced by CD40L or contact with allogeneic T cells, but not by LPS, whereas NIK is not required for any of these signals PMID: 12393548
  45. induction of noncanonical NF-kappaB signaling may involve the rescue of NIK from TRAF3-mediated negative regulation PMID: 15084608
  46. subcellular distribution of NIK to different compartments might be a means of regulating the function of this kinase PMID: 15252129
  47. Results for the first time place NF-kappa B-inducing kinase (NIK), previously shown to function in TNF signaling, within the interferon signal transduction pathway PMID: 16009713
  48. This study demonstrates that NF-kappaB-inducing kinase (NIK) is a critical target of the endogenous ROS in NF-kappaB pathways. PMID: 17729113
  49. NF-kappaB-inducing kinase phosphorylates and blocks the degradation of Down syndrome candidate region 1 PMID: 18056702
  50. NIK functions downstream of Cot to mediate p65 phosphorylation. PMID: 18439422

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, MAP kinase kinase kinase subfamily
Tissue Specificity
Weakly expressed in testis, small intestine, spleen, thymus, peripheral blood leukocytes, prostate, ovary and colon.
Database Links

HGNC: 6853

OMIM: 604655

KEGG: hsa:9020

UniGene: Hs.404183

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*