Recombinant Human Monocyte differentiation antigen CD14(CD14),partial

Code CSB-EP004879HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P08571
Relevance In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Myeloid cell-specific leucine-rich glycoprotein; CD14
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Research Area Immunology
Source E.coli
Gene Names CD14
Expression Region 20-345aa
Tag Info N-terminal GST-tagged
Mol. Weight 62.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Coreceptor for bacterial lipopolysaccharide
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Secreted, Membrane raft, Golgi apparatus
Tissue Specificity Detected on macrophages (at protein level) (PubMed:1698311). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages.
Database Links

HGNC: 1628

OMIM: 158120

KEGG: hsa:929

STRING: 9606.ENSP00000304236

UniGene: Hs.163867

Pathway MAPK signaling pathway
NF-kappa B signaling pathway
Regulation of actin cytoskeleton
Hematopoietic cell lineage
Toll-like receptor signaling pathway

Related Products

CD14 Antibodies

CD14 Antibodies for Homo sapiens (Human)

CD14 Antibodies for Human

CD14 Proteins

CD14 Proteins for Homo sapiens (Human)

CD14 ELISA Kit

CD14 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.