Recombinant Human Monocyte differentiation antigen CD14 (CD14)

Code CSB-EP004879HU
Abbreviation Recombinant Human CD14 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CD 14; CD_antigen=CD14; CD14; CD14 antigen; CD14 molecule; CD14_HUMAN; LPS-R; Mo2; Monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14 urinary form; Monocyte differentiation antigen CD14; membrane-bound form; Myeloid cell specific leucine rich glycoprotein; Myeloid cell-specific leucine-rich glycoprotein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-345aa
Target Protein Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Discover the exceptional quality of our Recombinant Human CD14 protein, designed to support your immunology research requirements. Expressed in E. coli, this full length mature protein (20-345aa) is equipped with an N-terminal GST-tag for seamless purification and detection. With a purity greater than 90% as determined by SDS-PAGE, our CD14 protein guarantees reliable and consistent outcomes.

Explore the intricacies of monocyte differentiation antigens and their roles in immune responses using our premium recombinant protein. Available in both liquid and lyophilized powder forms, our Recombinant Human CD14 protein is a valuable addition to your immunology research arsenal.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-).
Gene References into Functions
  1. high plasma levels of sCD14 is associated with measles virus infection. PMID: 29795672
  2. a considerable connection of DEFB1 and TCF7L2 gene polymorphisms with nephrolithiasis PMID: 29959006
  3. CD14 C-(260)T polymorphism is not associated with incidence of acute myocardial infarction in Egyptians who showed elevated serum CD14 levels in PMID: 29874995
  4. This study provides better understanding of the mechanisms and disease susceptibility for MIF and CD14 genetic variants and inflammatory miRNAs networks involved in ankylosing spondylitis and polyarthralgia. PMID: 29863307
  5. Childhood-onset and adult-onset of asthma showed significant difference in allergen sensitivity as well as genetic background with respect to CD14 polymorphism. PMID: 29937881
  6. Renal transplant recipients carrying the CD14-159 TT genotype have significantly higher risk of acute rejection and reduced transplant survival rate than patients with heterozygous or wild-type genotypes. PMID: 28411360
  7. The accumulating evidence does not support an association of CD14 SNP rs2569190 with AR risk. [meta-analysis] PMID: 29687183
  8. It seems that CD14 gene polymorphism might be associated with the risk of CAD, whereas COL4A1 gene polymorphism was not found to confer any risk of CAD PMID: 29299748
  9. higher sCD14 levels in HIV-positive women were associated with a more compromised maternal immunological status and to a lower neonatal birthweight, but not to poorer clinical outcomes in the HIV-exposed children PMID: 29323435
  10. The -221G>C polymorphism of MBL2, the -159C>T polymorphism of CD14 and the TNF-857 polymorphism of TNF-a are risk factors for spinal spinal tuberculosis (TB) and may be involved in the development of spinal TB in the Chinese population. These factors are indicators of susceptibility to spinal TB and require clinical attention. PMID: 29298876
  11. genetic variation of CD14, rs5744455, is related to the susceptibility to laryngeal cancer, providing a theoretical basis for the study of the pathogenesis of laryngeal PMID: 29077168
  12. Calcitriol regulates immune genes CD14 and CD180 to modulate LPS responses in human trophoblasts. PMID: 29089453
  13. The findings suggest that smoking and the presence of TNFalpha-308 GA/AA genotypes may increase the risk for peri-implantitis, while CD14-159 polymorphic CT/TT genotypes decrease the risk. PMID: 28906511
  14. Our results demonstrate that the expression of CD163 and CD206 in monocytes is modulated by LPS in vitro; LPS induces CD163 expression and downregulates the spontaneously increased expression of CD206 PMID: 25914252
  15. may be a simple and easy approach to assess by RT-FCM the reaction between NO and superoxide ion in whole blood monocytes..The no-wash, no-lyse staining protocol with CD45-KO and CD14-PB allows to differentiate clearly and to gate in the monocyte population in near-physiological conditions PMID: 25758468
  16. Association of polymorphic markers of chemokine genes, their receptors, and CD14 gene with coronary atherosclerosis PMID: 29369549
  17. data confirm that engineered human cells expressing TLR4, MD2 and CD14 can respond to CMP with NF-kappaB activation and the response can be influenced by variations in CMP-mannosylation PMID: 29281684
  18. hypothesize that CD14(-159C/T) polymorphic variants might be one of genetic components in the response to attenuated M. bovis BCG bacilli PMID: 29281719
  19. Higher sCD14 levels were found in twins with schizophrenia or bipolar disorder compared to their not affected co-twins, and higher sCD14-levels were associated with psychotic symptoms. PMID: 28039552
  20. novel observation that sCD14 compared with lipopolysaccharide binding protein, offers a preferred target to ameliorate TLR especially TLR4-induced inflammation and insulin resistance in human obesity and metabolic syndrome PMID: 26880233
  21. For asthma, there was suggestive evidence of a gene-by-environment interaction for the CD14 variant rs2569190 (Interaction P = 0.16) but not for the TLR4 variants rs4986790 and rs4986791. PMID: 27977294
  22. the simultaneous detection of both plasma sCD14 and IL-6 is a promising diagnostic approach to identify active pulmonary tuberculosis, and further, measurement of TNF-alpha and sCD163 can identify the most severe cases of tuberculosis. PMID: 27591510
  23. the methylation levels in the promoter region of CD14 gene were higher in the Finnish compared to Russian Karelian children PMID: 27434019
  24. Anti-apoA-1 IgG are independent predictors of nonfatal incident coronary artery disease in the general population. The strength of this association is dependent on a functional polymorphism of the CD14 receptor gene, a finding suggesting a gene-autoantibody interaction for the development of CAD. PMID: 29074586
  25. CD14 haplotypes and sCD14 are important mediators of lung function among those with COPD in this occupationally-exposed population. PMID: 28302109
  26. IL-1beta-primed dendritic cells express high levels of CD14 that mediate IL-17 production through direct interaction with T cells. PMID: 27550748
  27. The distribution of the CD14 rs2569190 genotypes and allele frequencies showed significant differences between the test and control groups. Prevalence of the polymorphic TT genotype and T allele of the CD14 rs2569190 were significantly increased in GCP patients when compared with healthy controls PMID: 28829191
  28. Presepsin is significantly higher in preterm infants with early-onset sepsis compared with uninfected infants. PMID: 27925621
  29. Neovascularized atherosclerotic lesions selectively associate with lower blood levels of CD14+ and CD14(high)CD16- monocytes independently of systemic inflammatory activity. PMID: 27751505
  30. CXCR7 mediates CD14(+)CD16(+) monocyte transmigration across the blood brain barrier, and is a potential therapeutic target for neuro AIDS. PMID: 28754798
  31. META-ANALYSIS: association between the -159C/T polymorphism in the promoter region of the CD14 gene and sepsis PMID: 28122493
  32. In LPS-stimulated HEK293 cells with low CD14 and high TLR4, no accumulation of PI(4,5)P2 occurred. With an increasing amount of CD14 and decrease of TLR4, 2 peaks of PI(4,5)P2 appeared, approaching those found in LPS-stimulated cells expressing CD14 alone. This suggests that LPS-induced accumulation of PI(4,5)P2 that maximizes TLR4 signaling is controlled by CD14, whereas TLR4 can fine tune this via PI(4,5)P2 turnover. PMID: 27418354
  33. Intermediate CD14++CD16+monocytes might be closely related to the pathogenesis of atrial fibrillation and reflect functional remodelling of the left atrium. PMID: 26826137
  34. In 121 primary sclerosing cholangitis patients, the CD14 -260C>T genotype was associated with development of dominant bile duct strictures (P = 0.02). In 365 liver transplantation patients, TT carriers (4.1%) were protected against the formation of nonanastomotic biliary strictures versus CC/CT patients (12.6%; P = 0.01). PMID: 26970220
  35. response of hPdLSCs to bacterial LPS is strongly augmented by sCD14 PMID: 27504628
  36. analysis of plasma CXCL10, sCD163 and sCD14 in virological suppression and risk of cardiovascular disease PMID: 27355513
  37. TGM2 has a role in macrophage differentiation via mechanisms involving CD14 and SR-AI receptors. PMID: 27378395
  38. we found that higher percentages of circulating CD14+CD204+, CD14+CD163+CD204+ M2-like monocytes were significantly associated with TNM stage, lymph node metastasis, and histological differentiation. PMID: 28639912
  39. these results indicate that CD14 is a co-receptor of TLR4 in the S100A9-induced cytokine response. PMID: 27228163
  40. our data showed the contribution on the TLR4+896A/G and CD14-159C/T polymorphism-related immune dysfunction including increased non-classical (inflammatory) monocyte proportion-related LPS hyper-inflammatory response and decreased classical (phagocytic) monocyte proportion-related impaired phagocytosis in febrile acute de-compensated cirrhotic patients complicated with severe sepsis. PMID: 27861595
  41. Plasma presepsin concentrations are associated with the severity of sepsis and its outcome. PMID: 28099244
  42. Presepsin is a valuable new biomarker for defining severe infections in cirrhosis, proving same efficacy as procalcitonin. However, it is not a useful marker of short-term mortality. PMID: 27895404
  43. Patients with CD14 C (-159) T gene polymorphism, a co-receptor of TLR4, have an increased risk of NAFLD development. PMID: 27895422
  44. Single nucleotide polymorphism CD14-159 C/T was linked to greater Atopic dermatitis risk at 2 to 3 years of age. PMID: 27274543
  45. While there was no association with any respiratory phenotype (as determined by symptoms), the CD14 CT/TT genotype appeared to be protective to increased exposure to NO2 and NO PMID: 27142357
  46. CD14 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  47. we report that exogenous CnB is taken up by cells in a time- and concentration-dependent manner via clathrin-dependent receptor-mediated internalization. Our findings further confirm that uptake is mediated by the TLR4/MD2 complex together with the co-receptor CD14 PMID: 27090571
  48. Cord blood sCD14 may be a useful biomarker for predicting infant wheeze and prolonged cough by 1 year of age. PMID: 27144407
  49. Presepsin is a valuable biomarker to detect patients with acute pyelonephritis PMID: 27889429
  50. diagnostic accuracy of presepsin (sCD14-ST) as a biomarker of infection and sepsis PMID: 27823951

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Membrane raft. Golgi apparatus.
Tissue Specificity
Detected on macrophages (at protein level). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages.
Database Links

HGNC: 1628

OMIM: 158120

KEGG: hsa:929

STRING: 9606.ENSP00000304236

UniGene: Hs.163867

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*