Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CD 14; CD_antigen=CD14; CD14; CD14 antigen; CD14 molecule; CD14_HUMAN; LPS-R; Mo2; Monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14 urinary form; Monocyte differentiation antigen CD14; membrane-bound form; Myeloid cell specific leucine rich glycoprotein; Myeloid cell-specific leucine-rich glycoprotein
Species
Homo sapiens (Human)
Expression Region
20-345aa
Target Protein Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This recombinant Human CD14 is a Mammalian cell-expressed protein (Full Length of Mature Protein) with N-terminal 6xHis tag, and it's purified by affinity chromatography method with a purity of 90%+ as determined by SDS-PAGE. Mammalian cell expression system can be used to produce proteins transiently or through stable cell lines, we usually use the transient method for Mammalian cell system protein expression, where the exogenous plasmid is transferred into the cell, and the transcription and translation are directly replicated in the cell. While stable cell lines can be used over several experiments, transient production can generate large amounts of protein in one to two weeks. These transient, high-yield mammalian expression systems utilize suspension cultures and can produce gram-per-liter yields.
CD14 is a glycosylphosphatidylinositol (GPI)-anchored receptor that functions in the TLR4/MD-2 complex to initiate proinflammatory signaling events in response to gram-negative bacteria by recognizing lipopolysaccharide. CD14 has also been shown to be upregulated in tubular epithelial cells of the kidney after unilateral ureteral obstruction and during renal ischemia-reperfusion injury. Stephanie Buchheister et al. revealed that CD14 plays a protective role in inflammatory bowel disease (IBD) development by enhancing intestinal barrier function.