Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-MP004879HU |
| Product Type | Recombinant Protein |
| Size | US$1232 |
| Uniprot No. | P08571 |
| Relevance | In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Myeloid cell-specific leucine-rich glycoprotein; CD14 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | CD14 |
| Expression Region | 20-345aa |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 39.2kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Coreceptor for bacterial lipopolysaccharide |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor, Secreted, Membrane raft, Golgi apparatus |
| Tissue Specificity | Detected on macrophages (at protein level) (PubMed:1698311). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. |
| Database Links |
HGNC: 1628 OMIM: 158120 KEGG: hsa:929 STRING: 9606.ENSP00000304236 UniGene: Hs.163867 |
| Pathway |
MAPK signaling pathway
NF-kappa B signaling pathway Regulation of actin cytoskeleton Hematopoietic cell lineage Toll-like receptor signaling pathway |
CD14 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004879GA01HU | CD14 Antibody | Human | ELISA,WB,IHC |
| CSB-MA792948 | CD14 Monoclonal Antibody | Human | ELISA, IHC |
| CSB-PA07085B0Rb | CD14 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA07085C0Rb | CD14 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA07085D0Rb | CD14 Antibody, Biotin conjugated | Human | ELISA |
CD14 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-MA004879A0m | CD14 Monoclonal Antibody | Human, Mouse, Rabbit | ELISA, WB, IHC, IF, FC |
| CSB-PA07085A0Rb | CD14 Antibody | Human | ELISA, IHC, IF |
| CSB-MA004879A1m | CD14 Monoclonal Antibody | Human, Mouse, Rat, Rabbit | ELISA, WB, IHC, IF |
CD14 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP004879HU CSB-BP004879HU |
Recombinant Human Monocyte differentiation antigen CD14(CD14) | Yeast Baculovirus |
| CSB-EP004879HU | Recombinant Human Monocyte differentiation antigen CD14(CD14),partial | E.coli |
CD14 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E13199h | Human soluble cluster of differentiation 14,sCD14 ELISA Kit | serum, plasma, cell culture supernates, tissue homogenates, urine | 0.229 ng/mL |
Recombinant rat Microtubule-associated protein tau
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Macaca mulatta CD40 ligand(CD40LG),partial
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial,Yeast
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Sperm-egg fusion protein Juno(IZUMO1R)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Baculoviral IAP repeat-containing protein 5(Birc5)
Express system: E.coli
Species: Mus musculus (Mouse)
