Code | CSB-MP004879HU |
Size |
US$3696Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This recombinant Human CD14 is a Mammalian cell-expressed protein (Full Length of Mature Protein) with N-terminal 6xHis tag, and it's purified by affinity chromatography method with a purity of 90%+ as determined by SDS-PAGE. Mammalian cell expression system can be used to produce proteins transiently or through stable cell lines, we usually use the transient method for Mammalian cell system protein expression, where the exogenous plasmid is transferred into the cell, and the transcription and translation are directly replicated in the cell. While stable cell lines can be used over several experiments, transient production can generate large amounts of protein in one to two weeks. These transient, high-yield mammalian expression systems utilize suspension cultures and can produce gram-per-liter yields. CD14 is a glycosylphosphatidylinositol (GPI)-anchored receptor that functions in the TLR4/MD-2 complex to initiate proinflammatory signaling events in response to gram-negative bacteria by recognizing lipopolysaccharide. CD14 has also been shown to be upregulated in tubular epithelial cells of the kidney after unilateral ureteral obstruction and during renal ischemia-reperfusion injury. Stephanie Buchheister et al. revealed that CD14 plays a protective role in inflammatory bowel disease (IBD) development by enhancing intestinal barrier function.
|
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | CD14 |
Uniprot No. | P08571 |
Research Area | Immunology |
Alternative Names | CD 14; CD_antigen=CD14; CD14; CD14 antigen; CD14 molecule; CD14_HUMAN; LPS-R; Mo2; Monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14 urinary form; Monocyte differentiation antigen CD14; membrane-bound form; Myeloid cell specific leucine rich glycoprotein; Myeloid cell-specific leucine-rich glycoprotein |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 20-345aa |
Target Protein Sequence | TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 39.2kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
N-terminal 6xHis-Myc-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Tris-based buffer,50% glycerol |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Coreceptor for bacterial lipopolysaccharide. In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the LY96/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Acts as a coreceptor for TLR2:TLR6 heterodimer in response to diacylated lipopeptides and for TLR2:TLR1 heterodimer in response to triacylated lipopeptides, these clusters trigger signaling from the cell surface and subsequently are targeted to the Golgi in a lipid-raft dependent pathway. Binds electronegative LDL (LDL(-)) and mediates the cytokine release induced by LDL(-).
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Membrane raft. Golgi apparatus. |
Tissue Specificity | Detected on macrophages (at protein level). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. |
Database Links |
HGNC: 1628 OMIM: 158120 KEGG: hsa:929 STRING: 9606.ENSP00000304236 UniGene: Hs.163867 |