Recombinant Human ATP-dependent translocase ABCB1 (ABCB1), partial

In Stock
Code CSB-EP001046HU1
Abbreviation Recombinant Human ABCB1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117374h(A6) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ABCB1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP117374h(A6) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ABCB1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
ABC20; ABCB1; ATP binding cassette, sub family B (MDR/TAP), member 1; ATP-binding cassette sub-family B member 1; CD243; CLCS; Colchicin sensitivity; Doxorubicin resistance; GP170; MDR1; MDR1_HUMAN; Multidrug resistance 1; Multidrug resistance protein 1; P glycoprotein 1; P gp; P-glycoprotein 1; PGY1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
236-297aa
Target Protein Sequence
LSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
10.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Advance your research in transport processes with our high-quality Recombinant Human ABCB1 protein. This partial protein (236-297aa) is derived from E.coli, a reliable expression system for robust protein production. Designed with an N-terminal 6xHis-tag, the protein enables efficient purification and detection, ensuring that you have a reliable and consistent product for your research endeavors.

Our Recombinant Human ABCB1 protein, also known as ATP-dependent translocase ABCB1 or CD243, offers a purity greater than 90% as determined by SDS-PAGE. Available in both liquid and lyophilized powder forms, this exceptional protein is designed to support your research in the transport field, allowing you to explore the complexities of ATP-dependent transport mechanisms with precision and confidence.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Translocates drugs and phospholipids across the membrane. Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membrane. Participates mainly to the flop of phosphatidylcholine, phosphatidylethanolamine, beta-D-glucosylceramides and sphingomyelins. Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Gene References into Functions
  1. Conformational dynamics of P-glycoprotein in lipid nanodiscs and detergent micelles reveal complex motions on a wide time scale. PMID: 29511086
  2. Study demonstrated that TWIST protein expression was elevated in liver cancer tissue specimens and was positively correlated with MDR1 expression. Knockdown of TWIST increased the sensitivity of RHepG2 cells to antineoplastic agents through a reduction in MDR1 expression and drug efflux ability. PMID: 30066890
  3. the over-expression of SLC7A11, or supplementation with sufficiently cystine, or treatment with N-acetylcysteine significantly decreased P-gp expression and activity. It was suggested that ROS and SLC7A11/cystine were the two relevant factors responsible for the expression and function of P-gp, and that SLC7A11 might be a potential target modulating ADR resistance. PMID: 28630426
  4. Data provide a mechanistic explanation for the differential effects of ABCB1 haplotypes on its promoter activity and underscore the importance of evaluating genetic variants in the context of haplotypes rather than individual SNPs when investigating their effects on gene/protein expression and disease risk. PMID: 30277801
  5. CYP3A5, ABCB1 and two POR genotypes were assessed by real-time PCR. PMID: 28094348
  6. ABCB1 C3435T polymorphism can affect the elimination of some antipsychotic/antidepressant drugs. PMID: 29723928
  7. High BCL11A and MDR1 expression was associated with a poor response to chemotherapy. PMID: 29469608
  8. The methylation/expression ratios of ABCB1 were unaffected by increasing BMI values. PMID: 27897267
  9. Neither the ABCB1 C3435T nor the SLCO1B1 T521C polymorphism affected edoxaban PK. PMID: 27897269
  10. Our results show that ABCB1 C3435T polymorphism may modulate serum THC levels in chronic heavy cannabis users. The exact mechanisms and roles that this may play in cannabis dependence genesis and evolution remain to be elucidated. These results should be controlled in a replication study using a larger population. PMID: 28917442
  11. MDR1 is not expressed on erythrocyte membrane. PMID: 29098941
  12. The genetic polymorphisms of the multi-drug resistance-1 (MDR-1) and human cytochrome P450 3A (CYP3A4 and CYP3A5) genes were analyzed and compared between steroid sensitive, steroid resistant and control groups. PMID: 30143489
  13. This meta-analysis suggests that the MDR1 C > T polymorphism was not associated with the risk of MM. To confirm these findings, further comprehensive and well-designed studies are needed. PMID: 29495954
  14. High MDR1 expression is associated with chemoresistance in ovarian cancer. PMID: 29956807
  15. 13-cis-retinoic acid, retinol and retinyl-acetate inhibited the Pgp and ABCG2 mediated substrate transport as well as the substrate stimulated ATPase activity of these transporters. PMID: 28145501
  16. Haplotype analysis of ABCB1 conducted in patients with bullous pemphigoid demonstrated that the 1236T-2677G-3435T haplotype may protect against development of disease. PMID: 29948283
  17. High ABCB1 expression is associated with Bendamustine-resistance in Mantle Cell Lymphoma. PMID: 29695404
  18. Data show that multidrug resistance gene 1 (MDR1) expression was associated with worsen survival of esophageal squamous cell carcinoma (ESCC) patients with cisplatin-based chemotherapy. PMID: 29107111
  19. ABCB1 variation affected myelosuppression, progression-free survival and overall survival in ovarian cancer patients who were treated with paclitaxel and carboplatin PMID: 29504705
  20. Our data showed that the expression of the MDR1 gene was significantly higher in malignant tissue than in the normal tissues of patients with STS. In addition, high MDR1 expression was significantly associated with local advances, as well as poor response to treatment. PMID: 29689707
  21. These results indicated that MG132 reversed the MDR of hypopharyngeal carcinoma by downregulating Pgp/Pgp, and the underlying mechanism may be associated with the activation the of the JNK signaling pathway PMID: 29901180
  22. P-glycoprotein on peripheral blood leukocytes of systemic lupus erythematosus (SLE) patients with lupus arthritis may have a role in clinical response to methotrexate PMID: 28616661
  23. This study elaborated a novel UCA1/miR-129/ABCB1 regulatory axis underlying paclitaxel resistance of ovarian cancer cells. PMID: 29777711
  24. ABCB1 3435C>T and ATIC 347C>G SNPs were associated with abnormal hepatic enzyme elevation by methotrexate treatment in patients with rheumatoid arthritis. PMID: 29252093
  25. The role of multidrug resistance 1 gene (MDR1 or ABCB1) polymorphism G2677T was studied in relation to paroxetine therapeutic efficacy and its side effects, as well as its association with selected demographic and clinical characteristics of patients with depressive disorder. PMID: 29754150
  26. alterations in latrophilin expression occur in AML cells expressing P-gp PMID: 29938681
  27. This study demonstrated that the The G2677T T and C3435T T alleles as well as the TT, CTT and TTT haplotypes seemed to be significantly associated with drug-resistance epilepsy in Tunisian epileptic population. PMID: 29198163
  28. Pharmacokinetics of aripiprazole is affected by sex and ABCB1 gene phenotype PMID: 29325225
  29. There were no significant differences in the bosutinib C0 between genotypes for ABCB1, ABCG2, and CYP3A4 polymorphisms. PMID: 29736778
  30. Studies show a connection between UDP-glucose ceramide glucosyltransferase (UGCG) and multidrug resistance protein 1 (MDR1) overexpression and multidrug resistance development [Review]. PMID: 29409484
  31. Due to the downregulation of MDR1 and MRP1, the intracellular accumulation of ADM was increased in the transfected cells compared with that in the parental K562/ADM cells..Our research revealed that protein expression of the ERK signaling pathway was inhibited by downregulating TRIB2, indicating that the ERK pathway was involved in cell drug resistance and proliferation. PMID: 29436678
  32. Asiatic Acid strongly inhibited P-GP expression by blocking MDR1 gene transcription and increased the intracellular accumulation of the P-GP substrate Rhodamine 123 in MDR1-overexpressing cisplatin (DDP)-resistant lung cancer cells, A549/DDP. PMID: 29768255
  33. Ceritinib enhanced the efficacy of substrate chemotherapeutic agent in ABCB1-overexpressing K562/adr leukemia cells both in vitro and in vivo models, but neither in sensitive parental K562 leukemia cells nor in ABCC1-overexpressing HL-60/adr leukemia cells. PMID: 29742496
  34. Polymorphism of ABCB1 rs1045642-T variant allele is associated with colorectal cancer. PMID: 29282011
  35. There is a certain correlation between the APC gene and ovarian tumors, and the APC gene mediates the apoptosis of tumor cells through the MDR-1/CLCX-1 signaling pathway. PMID: 29921377
  36. ABCB1/Pgp expression, activity, and single nucleotide polymorphisms (SNPs) in chronic myeloid leukemia. [review] PMID: 29316665
  37. High MDR1 expression is associated with primary myelodysplastic syndrome. PMID: 27605311
  38. analysis of the structure of zosuquidar and UIC2-bound human-mouse chimeric ABCB1 PMID: 29440498
  39. ABCB1 gene polymorphisms are not associated with response to chemotherapy in breast cancer. PMID: 29113667
  40. Patients prescribed with short-term low-dose atorvastatin and carrying ABCB1 (rs1128503) or ABCG2 (rs2231142) SNPs did not show differences in LDL-C response (P>.05). PMID: 28833323
  41. Genotypes of UGT1A and ABCB1 were significantly associated with changes in moxifloxacin pharmacokinetic parameters. PMID: 29210323
  42. G2677T/A polymorphism of MDR1 may play a significant role in the development of drug-resistant epilepsy in the Polish patients PMID: 28608314
  43. No association was found between the ABCB1 SNPs and Crohn's disease in the two populations PMID: 28759738
  44. icaritin (ICT) decreased the mRNA and protein levels of multidrug resistance protein 1 (MDR1) in MG-63 doxorubicin-resistant (MG-63/DOX) cells. PMID: 29425587
  45. We demonstrate for the first time that the effect of ABCB1 diplotype on tacrolimus disposition is dependent on both CYP3A5 and CYP3A4 genotype. PMID: 27378609
  46. these results address key concerns in the field, including that of cross-resistance between taxanes and highlighting a mechanism of cabazitaxel resistance involving ABCB1 PMID: 28698198
  47. CYP3A and ABCB1 SNPs were detected in 521 recipients. PMID: 28952408
  48. MDR-1 C3435T gene polymorphism was associated with right ventricular dysfunction in patients with chronic obstructive pulmonary disease. PMID: 29791609
  49. data suggested that hypomethylation agent decitabine restores drug sensitivity in the P-gp-induced MDR phenotype by depressing of P-gp activity as drug pump partly through MAPK signaling pathway. PMID: 28405849
  50. None of the genotypes in ABCB1 1236 C>T, 2677 G>T/A, 3435 C>T, and 4036 A>G correlated with plasma dolutegravir concentration..The speculated peak level of plasma dolutegravir concentration was significantly higher in ABCG2 genetic variant holders, probably, at least in part, because of low expression levels of efflux transporters in the intestines associated with these genetic variants. PMID: 28858994

Show More

Hide All

Involvement in disease
Inflammatory bowel disease 13 (IBD13)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane.
Protein Families
ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily
Tissue Specificity
Expressed in liver, kidney, small intestine and brain.
Database Links

HGNC: 40

OMIM: 171050

KEGG: hsa:5243

STRING: 9606.ENSP00000265724

UniGene: Hs.489033

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*